ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

54806

Name

AHI1

Synonym

AHI-1|JBTS3|ORF1|dJ71N10.1;Abelson helper integration site 1;AHI1;Abelson helper integration site 1

Definition

abelson helper integration site 1 protein homolog|contatins SH3 and WD40 domains|jouberin

Position

6q23.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

54806

Links to epithelial mesenchymal transition gene database

54806

Links to ovarian cancer gene database

54806

Links to endometrial cancer gene database

54806

Links to iHOP

54806

Sequence Information

Nucleotide Sequence

>54806 : length: 7092
GCGCTGTCCGCACTGCGGCACAGAGCCGCGGCTTGCTTTCAGGACACGGGTCGCTGGCGG
GTTAGGTGGCTGCGTGGCCGCCTCACTTCGCGCACGCGCCGCTAGGCTGGGGGAGTTGAT
TTGCACTGCTCCGGGTGTCGGCTCCGGCGGGACGGGCGGTTCTGCGTACCCCTCTCCAGT
GTCAACCTGGGGCTGAATCTTCAACCTGTCAAAGCCTTCTTAATTATGTCTGAGAAAAGG
ATCCTGATTGAGTCAATGCTTTGCATTCTCAGTCCTCTGCATAAAGCTGAGAGATGCCTA
CAGCTGAGAGTGAAGCAAAAGTAAAAACCAAAGTTCGCTTTGAAGAATTGCTTAAGACCC
ACAGTGATCTAATGCGTGAAAAGAAAAAACTGAAGAAAAAACTTGTCAGGTCTGAAGAAA
ACATCTCACCTGACACTATTAGAAGCAATCTTCACTATATGAAAGAAACTACAAGTGATG
ATCCCGACACTATTAGAAGCAATCTTCCCCATATTAAAGAAACTACAAGTGATGATGTAA
GTGCTGCTAACACTAACAACCTGAAGAAGAGCACGAGAGTCACTAAAAACAAATTGAGGA
ACACACAGTTAGCAACTGAAAATCCTAATGGTGATGCTAGTGTAGAGGAAGACAAACAAG
GAAAGCCAAATAAAAAGGTGATAAAGACGGTGCCCCAGTTGACTACACAAGACCTGAAAC
CGGAAACTCCTGAGAATAAGGTTGATTCTACACACCAGAAAACACATACAAAGCCACAGC
CAGGCGTTGATCATCAGAAAAGTGAGAAGGCAAATGAGGGAAGAGAAGAGACTGATTTAG
AAGAGGATGAAGAATTGATGCAAGCATATCAGTGCCATGTAACTGAAGAAATGGCAAAGG
AGATTAAGAGGAAAATAAGAAAGAAACTGAAAGAACAGTTGACTTACTTTCCCTCAGATA
CTTTATTCCATGATGACAAACTAAGCAGTGAAAAAAGGAAAAAGAAAAAGGAAGTTCCAG
TCTTCTCTAAAGCTGAAACAAGTACATTGACCATCTCTGGTGACACAGTTGAAGGTGAAC
AAAAGAAAGAATCTTCAGTTAGATCAGTTTCTTCAGATTCTCATCAAGATGATGAAATAA
GCTCAATGGAACAAAGCACAGAAGACAGCATGCAAGATGATACAAAACCTAAACCAAAAA
AAACAAAAAAGAAGACTAAAGCAGTTGCAGATAATAATGAAGATGTTGATGGTGATGGTG
TTCATGAAATAACAAGCCGAGATAGCCCGGTTTATCCCAAATGTTTGCTTGATGATGACC
TTGTCTTGGGAGTTTACATTCACCGAACTGATAGACTTAAGTCAGATTTTATGATTTCTC
ACCCAATGGTAAAAATTCATGTGGTTGATGAGCATACTGGTCAATATGTCAAGAAAGATG
ATAGTGGACGGCCTGTTTCATCTTACTATGAAAAAGAGAATGTGGATTATATTCTTCCTA
TTATGACCCAGCCATATGATTTTAAACAGTTAAAATCAAGACTTCCAGAGTGGGAAGAAC
AAATTGTATTTAATGAAAATTTTCCCTATTTGCTTCGAGGCTCTGATGAGAGTCCTAAAG
TCATCCTGTTCTTTGAGATTCTTGATTTCTTAAGCGTGGATGAAATTAAGAATAATTCTG
AGGTTCAAAACCAAGAATGTGGCTTTCGGAAAATTGCCTGGGCATTTCTTAAGCTTCTGG
GAGCCAATGGAAATGCAAACATCAACTCAAAACTTCGCTTGCAGCTATATTACCCACCTA
CTAAGCCTCGATCCCCATTAAGTGTTGTTGAGGCATTTGAATGGTGGTCAAAATGTCCAA
GAAATCATTACCCATCAACACTGTACGTAACTGTAAGAGGACTGAAAGTTCCAGACTGTA
TAAAGCCATCTTACCGCTCTATGATGGCTCTTCAGGAGGAAAAAGGTAAACCAGTGCATT
GTGAACGTCACCATGAGTCAAGCTCAGTAGACACAGAACCTGGATTAGAAGAGTCAAAGG
AAGTAATAAAGTGGAAACGACTCCCTGGGCAGGCTTGCCGTATCCCAAACAAACACCTCT
TCTCACTAAATGCAGGAGAACGAGGATGTTTTTGTCTTGATTTCTCCCACAATGGAAGAA
TATTAGCAGCAGCTTGTGCCAGCCGGGATGGATATCCAATTATTTTATATGAAATTCCTT
CTGGACGTTTCATGAGAGAATTGTGTGGCCACCTCAATATCATTTATGATCTTTCCTGGT
CAAAAGATGATCACTACATCCTTACTTCATCATCTGATGGCACTGCCAGGATATGGAAAA
ATGAAATAAACAATACAAATACTTTCAGAGTTTTACCTCATCCTTCTTTTGTTTACACGG
CTAAATTCCATCCAGCTGTAAGAGAGCTAGTAGTTACAGGATGCTATGATTCCATGATAC
GGATATGGAAAGTTGAGATGAGAGAAGATTCTGCCATATTGGTCCGACAGTTTGATGTTC
ACAAAAGTTTTATCAACTCACTTTGTTTTGATACTGAAGGTCATCATATGTATTCAGGAG
ATTGTACAGGGGTGATTGTTGTTTGGAATACCTATGTCAAGATTAATGATTTGGAACATT
CAGTGCACCACTGGACTATAAATAAGGAAATTAAAGAAACTGAGTTTAAGGGAATTCCAA
TAAGTTATTTGGAGATTCATCCCAATGGAAAACGTTTGTTAATCCATACCAAAGACAGTA
CTTTGAGAATTATGGATCTCCGGATATTAGTAGCAAGGAAGTTTGTAGGAGCAGCAAATT
ATCGGGAGAAGATTCATAGTACTTTGACTCCATGTGGGACTTTTCTGTTTGCTGGAAGTG
AGGATGGTATAGTGTATGTTTGGAACCCAGAAACAGGAGAACAAGTAGCCATGTATTCTG
ACTTGCCATTCAAGTCACCCATTCGAGACATTTCTTATCATCCATTTGAAAATATGGTTG
CATTCTGTGCATTTGGGCAAAATGAGCCAATTCTTCTGTATATTTACGATTTCCATGTTG
CCCAGCAGGAGGCTGAAATGTTCAAACGCTACAATGGAACATTTCCATTACCTGGAATAC
ACCAAAGTCAAGATGCCCTATGTACCTGTCCAAAACTACCCCATCAAGGCTCTTTTCAGA
TTGATGAATTTGTCCACACTGAAAGTTCTTCAACGAAGATGCAGCTAGTAAAACAGAGGC
TTGAAACTGTCACAGAGGTGATACGTTCCTGTGCTGCAAAAGTCAACAAAAATCTCTCAT
TTACTTCACCACCAGCAGTTTCCTCACAACAGTCTAAGTTAAAGCAGTCAAACATGCTGA
CCGCTCAAGAGATTCTACATCAGTTTGGTTTCACTCAGACCGGGATTATCAGCATAGAAA
GAAAGCCTTGTAACCATCAGGTAGATACAGCACCAACGGTAGTGGCTCTTTATGACTACA
CAGCGAATCGATCAGATGAACTAACCATCCATCGCGGAGACATTATCCGAGTGTTTTTCA
AAGATAATGAAGACTGGTGGTATGGCAGCATAGGAAAGGGACAGGAAGGTTATTTTCCAG
CTAATCATGTGGCTAGTGAAACACTGTATCAAGAACTGCCTCCTGAGATAAAGGAGCGAT
CCCCTCCTTTAAGCCCTGAGGAAAAAACTAAAATAGAAAAATCTCCAGCTCCTCAAAAGG
TGGGGGATAATACTGGTGGGCAGAGGTCATGGATGTTGCTCAGTATCCTAGAATGCAGAG
GACAGCTCCCCTCAACAAAGAATTCTCTGGCCAAAAATGTCAACAGGATGGAGCTTAGAG
CAGTGCCCCTCTAAACAGGTAAAATAAAACAAAACAGCTCACAGAGACACCTCCTTCTTC
CCCCTGCTTCTGCCTCCATGAGTAACTACCTATATGACGTGCTGCTGCTGAGACCAAGGA
ATGAGTGAGTAAAGGTGTTTGGAAGTCAAATATTGGTCCTAGTTAAGTAAGTGTCCTTTT
CAAGTAAGTGGTAAACTTTGTAATGTGGACCCCCTTCTAACTTAGGATTCATATAATTTG
AACACAGGCTAAGCTGCCTCTGCATCATTAAAAAGGATTTGGGTATGCCAGTGATAGGAA
TACACAGTAGAAAAGATGGCAGGGACCATGTTTAACATACCTAAGACAAACTTTCTGAGG
ATATCACAGCATCCATTTCACATGAACAGGCTTAGCAGAATTGGCAAGACCTGCACATGG
CAACATATTATTCATTTTTCAGGATAACAAAAAATAATTAAAAGTAACATTGGCTTAACA
CTGGTATATAGTTCAGTATGACTTCTCTCCCCTCAACCTCTGGAATAGGTTCAAATTGAT
GAGAATTTCTGATTAGAGCCCTTAATGTTGAGTTTTTTGAAAAGTTTTATCAAGTTTCAT
ATATACCTATATTGATGGTAAGTTGCTGGTCTTGCCATGGGCAAAGAGAGAAAAATGATA
CTGAGACCTTGTAAAGAATAGCTGGACATGGAGGCGCACACCTGTAATCCCAGCAACTCA
GAAGGCTGAGGCGGGAGGATTGCTTGAGCCCAGGAGTTCAAGGCTGCAGTGAGCTACGAT
CATGCCACTGTACTCCAGCCTGAGCAACAAAGCATGACCCAATCTCTTAAAAAAAAGAAA
AGAATAAAACATTTCACATTTAATTTGACTGCTGTGTTTAGAATTTATTTCACAAGTCTG
GAAAGAAACAGGATAATTTCTGTTATGATGGTGCTTTCTGAGGTTTTGATGATTTTCTTT
GCTTATTGTTCTATTGGATGAGGGCAGTCTGAATTAGTAGTTGAATCTGAAATTTCCCGT
GTGTATGTACTTTTTTCCCAAACACGTTTTAACTGAGTCAGAGCAATTCCACTGGTGGAG
AAAAATTAAGATGTCATGGGTTCTTTTGTTGTTCTACCAAATGGGTCACCTGTTGCAACA
CTCACCTTTCACCAAAAAGTCTCCTTGCTCTTTAATTCTTGTTTTTATTATGCTTGACTT
AAAGCTCTACAGCTAGCAGTAATAATCATATAATTATGGTCCAGAAAAGCATAATATCCT
CTTGAAATCTGTAAGAAAAGTAATGCTTGTTTAAAGATAGTGCCAAATCTTGCTGAAGAA
TGATCTTGCAGAAATCTGATTGTGAAGAAGGAAATCTAAAAAGGCCAAACAAGCTTCAGT
AGAGATAACACCAGGAAAGCAGTTACTCAAACAAGACTGAAAGAGAAGCAATCAATCAAT
AAGAACAAGTCCCAGGACTTCAGACTAGGCTCAGAATCTATGACACATTCTGAAATGAGA
AAAGAACAGAGCCATGAGGACCAAGGACACATAATGGATACACGGATGAGGAAGAACAAG
CAAGCAGGCAGAAAAGTCACTCTAATAGAGTAAAGAATTGAAGAAAAGTTAAGAGCTGCC
GAAATGCACAGAGGTGAAAATGACAAACCAAATGGAATTTCTCTTCAGAGTTCAGAATTT
TCAGATACTAAGGAGGAAGAAAGGATCCACTACTTCTTGTTCTTATGAATGACTCTAGAA
AAATCAGAATCAAGTTGTGGGTGGAAAAATCAACGTGGCCTTTGAGTTCAGTTGTTATAA
ACCATTGTGACTATTGTTGGTCAAAGTATTGGTACTTATATTGTTAGTAATTGCATCATA
ATTACATTACCAGTGTTGGAAAACTAATGAAGAAAACACTGTAATTGCTACTCAGCAAAT
GTGAATAAAAGGTGTTTGCGTTATTAGGATGTCTGTTAAGTAATCATTTAATATTATTAT
ATTGGTAATGGTTGTATGTGTGATGCTATGCCCAGAATATGAAGTATCTGTTTTTGAAAT
TCACTTTATTTAAAAGATAAGCAGCTGACTGGGCACGGTGCCTCATGCCTGTAATCCTAG
CACCTTGGGAGGCTGAGGCAGGTGGATCACCTAAGGTCAGGAGTTCAACAACACCAGCCT
GACCAACATGGTGAAACCCCATCTCTACTAAAAATACAAAAATCAGCCGGGTCTCATGGC
AGGCACCTGTAATCCCATCTACTGAGGCAGGAGAATTGCTTGACCCAGGAGGCAGAGGTT
GCAGTGAGCCAAGATCACGCCATTGCACTCCAGCCTGGGGGACAGAGCAAGACTCTATCT
CCAAAAAACAAAAAAGATAAGCAGCTTTAGAATATGGCGCATTCAAAACAGTCTCAGTAA
CAAAGACATTAAAAGAAAACAATTTACTTTCTAATTAAAATTTTGTGTTTCTTAAGATCA
AATCATATAGGTAACTTCATAGACCTAAATTAAAAGTGATTTTTGGCTGGACTGGCAACA
ATGTTCCCAATGTCTTTACTTTTTAAAAAAGGCTTTTCATATTTAAGCACATACCTATTT
TGTAGACTTACATTGTTTAATATTTATTTTAATCTTAATATTTTTACATTATTATATTGC
ATTATTTATTTTTTCTAAGTTCCAGAATAATAGTGTCATTATTATAGACTATATGTTTTG
AAGTTTGATATTATAATGGGATATTCATTTTTTGTTCTTTTCTTGACTCCTTTCTCAAGT
GTGTGATAAGGTCTGCTGATAAAATATTTAACCCCAAGAAAGTGAAAACTAATATAAAAT
TAGAAAGACCTATCCAAATTAGACAGTCAATTCCATTAAAATAAGAAGTGAGAAAAACAA
TGTTGGGCATTGAGGTGTAAATTTTGCCCAGATGTATACCCAGTGTGAAATATCTTCTAA
TAAAAATATATTTGGCTCTTATCCCTGCACATGTAGAGGCATAAAAATTGGTAAACATGT
CCCGCTGTGTAGAACTTTAAAAAAAAGGCATTTTTGAAAGTGTTGAGTGGCACTGATAAC
TGGTGAAGCCTACAGCCATCCGCCCAAAAGTCTGTTCTGATGGCACTGAGTTTTCATTGT
TCTGGATGTATAAGTCTGTGTGTCAGGTACAGCTGGGCCCAGCCAGCTTGAGTCACTCTT
GTACAAGCTTGTTTTTTTCTGTCTTGTGAATGCACTTGATAATTTAAAAATAAAAATATC
TGTTTCTCTGCA

Protein Sequence

>54806 : length: 1196
MPTAESEAKVKTKVRFEELLKTHSDLMREKKKLKKKLVRSEENISPDTIRSNLHYMKETT
SDDPDTIRSNLPHIKETTSDDVSAANTNNLKKSTRVTKNKLRNTQLATENPNGDASVEED
KQGKPNKKVIKTVPQLTTQDLKPETPENKVDSTHQKTHTKPQPGVDHQKSEKANEGREET
DLEEDEELMQAYQCHVTEEMAKEIKRKIRKKLKEQLTYFPSDTLFHDDKLSSEKRKKKKE
VPVFSKAETSTLTISGDTVEGEQKKESSVRSVSSDSHQDDEISSMEQSTEDSMQDDTKPK
PKKTKKKTKAVADNNEDVDGDGVHEITSRDSPVYPKCLLDDDLVLGVYIHRTDRLKSDFM
ISHPMVKIHVVDEHTGQYVKKDDSGRPVSSYYEKENVDYILPIMTQPYDFKQLKSRLPEW
EEQIVFNENFPYLLRGSDESPKVILFFEILDFLSVDEIKNNSEVQNQECGFRKIAWAFLK
LLGANGNANINSKLRLQLYYPPTKPRSPLSVVEAFEWWSKCPRNHYPSTLYVTVRGLKVP
DCIKPSYRSMMALQEEKGKPVHCERHHESSSVDTEPGLEESKEVIKWKRLPGQACRIPNK
HLFSLNAGERGCFCLDFSHNGRILAAACASRDGYPIILYEIPSGRFMRELCGHLNIIYDL
SWSKDDHYILTSSSDGTARIWKNEINNTNTFRVLPHPSFVYTAKFHPAVRELVVTGCYDS
MIRIWKVEMREDSAILVRQFDVHKSFINSLCFDTEGHHMYSGDCTGVIVVWNTYVKINDL
EHSVHHWTINKEIKETEFKGIPISYLEIHPNGKRLLIHTKDSTLRIMDLRILVARKFVGA
ANYREKIHSTLTPCGTFLFAGSEDGIVYVWNPETGEQVAMYSDLPFKSPIRDISYHPFEN
MVAFCAFGQNEPILLYIYDFHVAQQEAEMFKRYNGTFPLPGIHQSQDALCTCPKLPHQGS
FQIDEFVHTESSSTKMQLVKQRLETVTEVIRSCAAKVNKNLSFTSPPAVSSQQSKLKQSN
MLTAQEILHQFGFTQTGIISIERKPCNHQVDTAPTVVALYDYTANRSDELTIHRGDIIRV
FFKDNEDWWYGSIGKGQEGYFPANHVASETLYQELPPEIKERSPPLSPEEKTKIEKSPAP
QKQSINKNKSQDFRLGSESMTHSEMRKEQSHEDQGHIMDTRMRKNKQAGRKVTLIE