ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

54738

Name

FEV

Synonym

HSRNAFEV|PET-1;FEV (ETS oncogene family);FEV;FEV (ETS oncogene family)

Definition

PC12 ETS domain-containing transcription factor 1|fifth Ewing variant protein|protein FEV

Position

2q36

Gene Type

protein-coding

Pathways and Diseases

Pathway

PDGF signaling pathway;PANTHER;P00047

Disease

DEVELOPMENTAL;GAD

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Cancers;KEGG DISEASE

Disease

Ewing's sarcoma;KEGG DISEASE;H00035

Disease

height;GAD

External Links

Links to cell senescence gene database

54738

Links to epithelial mesenchymal transition gene database

54738

Links to ovarian cancer gene database

54738

Links to endometrial cancer gene database

54738

Links to iHOP

54738

Sequence Information

Nucleotide Sequence

>54738 : length: 1901
GCGGCGAGTGGAGCGGGAGCCGACTGGAAGAAGGGCTCTAGGGAGGGGGCTGTGGCTGCT
GGGGTCCGAGGTGGGGCCGGGTACACCAGCCCCATCACTGTTTGCAGAGAGTCAGGGAGG
CGGAAAAGACACGCGCTCTAGGCTCCCATCAGGGCACATGGCCCGGGCCCATCCCCCGCG
CGTCTCCCCGGCTGCGGGGCGCGGGGGGCTGCCGGGTGCGCTTGGCTGTGGCGCGGCGCG
TTGGAGACTTTATTGCGATGGGACGATAAGAGGGGCGGGGGCGGGGTCCTGGGGGCCGAG
GCGGCAGCGCTTTAATTAAAACGGAAATTGCGGCCCCGGGCCGCGCGGGGGCCGGAGGGT
TCCAAGCGGCCCCTTAGCTGGAAGCGTTTCTCCAGGACCCCCCCGCAACCCCCGCCACGC
CCGGGCTGCCCCCTCCCGCCAGGCCCTGCCGGACCCGGCGCCGTCTTCTCCTCCTTGTCA
CCCGCGGTCGCTTCGGGCGGGGATCGGTGCCACCGAGCGCAAAGCCTGCCTCGCCCCCCT
TCCCCGTCCCCCCCATCTCCCACCGCCCAGTCCCCGGCGGCGATGAGACAGAGCGGCGCC
TCCCAGCCCCTGCTGATCAACATGTACCTGCCAGATCCCGTCGGAGACGGTCTCTTCAAG
GACGGGAAGAACCCGAGCTGGGGGCCGCTGAGCCCCGCGGTTCAGAAAGGCAGCGGACAG
ATCCAGCTGTGGCAGTTTCTGCTGGAGCTGCTGGCTGACCGCGCGAACGCCGGCTGCATC
GCGTGGGAGGGCGGTCACGGCGAGTTCAAGCTCACGGACCCGGACGAGGTGGCGCGGCGG
TGGGGCGAGCGCAAGAGCAAGCCCAACATGAACTACGACAAGCTGAGCCGCGCCCTGCGC
TACTACTACGACAAGAACATCATGAGCAAGGTGCATGGCAAGCGCTACGCCTACCGCTTC
GACTTCCAGGGCCTGGCGCAGGCCTGCCAGCCGCCGCCCGCGCACGCTCATGCCGCCGCC
GCAGCTGCTGCCGCCGCCGCGGCCGCCCAGGACGGCGCGCTCTACAAGCTGCCCGCCGGC
CTCGCCCCGCTGCCCTTCCCCGGCCTCTCCAAACTCAACCTCATGGCCGCCTCGGCCGGG
GTCGCGCCCGCCGGCTTCTCCTACTGGCCGGGCCCGGGCCCCGCCGCCACCGCTGCCGCC
GCCACCGCCGCGCTCTACCCCAGTCCCAGCTTGCAGCCCCCGCCCGGGCCCTTCGGGGCC
GTGGCCGCAGCCTCGCACTTGGGGGGCCATTACCACTAGACGGGGCGGTCGGGTGCCTGC
GGCCTCGCCCGCACGCCTAGAGTCTCGCCCGATCCCATCGGCATCCCGGGGAGGGCCCGG
GAGCCTCCGTCAACCGTCCTCTAATCCAGAGTTTACTCCACCTGCCGCACTTAGCAGGGG
GACGGGACCGAAGCTCCCTCAATCCTTGTCTGGTACTAGATTTGCTCCTGTCCCACCCCG
CAGTCCCCTGAGGAGGGCGATGTGCGCCCTCTTTCACTTTTTTTCTTCTAGGTCTCCAGG
TCCCGGAGGGGATTTGTGGACCTCTCTTGTCTCCCCACCACTCCAGTGCATTTCCGCCTG
GCTCCTAGAAGCCCCATTCAATATCACTACTCTTTAACGAGTGCCAAATCTTTTCCCACT
TTTGCTCTTCCCCAAGGAACTGCTCCCACCTCAGCACGTGGAGGCCTCTCACGGTCCTCC
TTCCTGGGACCTGAGCAGGTTTGGTGAAAGCCACCGTCCTCCGTGACACACGGCCCCCTT
CCTCCTGTCCCCACACTCCCAGGAGAAACTCCCGGTGTGTTTCTGACCCTTTCAGCCCCA
TTAAAGCTCCTGAGCTCTCAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>54738 : length: 238
MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADR
ANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGK
RYAYRFDFQGLAQACQPPPAHAHAAAAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLNL
MAASAGVAPAGFSYWPGPGPAATAAAATAALYPSPSLQPPPGPFGAVAAASHLGGHYH