ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

54680

Name

ZNHIT6

Synonym

BCD1|C1orf181|NY-BR-75;zinc finger, HIT-type containing 6;ZNHIT6;zinc finger, HIT-type containing 6

Definition

box C/D snoRNA essential 1 homolog|box C/D snoRNA protein 1|serologically defined breast cancer antigen NY-BR-75|zinc finger HIT domain-containing protein 6|zinc finger, HIT type 6

Position

1p22.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

54680

Links to epithelial mesenchymal transition gene database

54680

Links to ovarian cancer gene database

54680

Links to endometrial cancer gene database

54680

Links to iHOP

54680

Sequence Information

Nucleotide Sequence

>54680 : length: 6197
AGTCGCGTCAAGCAGGCTATTCCGGGTTTGTGGCTGCTTGGCTCCACACGTGGGCCGCCG
TAGGTATTCCGACCGGTAATTCCTCCTATTGGTGTGCAGCAGCCACATTGAAGGATAGAG
TGGCAGCAGAGGCCAAGGATCGTGAGTTGATGGAGTTTGCTGCTGAAAATGAAGGGAAGT
CTGGGGGAGGTCTCCACAGCGTAGCTGAGGGGGTGCGGCTAAGTCCAGAGCCTGGCAGGG
AGGGAGTAAGGGACTTAGCAGGGGCGGAGGAGTTCGGCGGCGGAGAGGAGGGGACAGGGC
TGACAGGGATAAAGGAGATAGGGGATGGAGAGGAAGGAAGTGGACAAAGGCCAGAGGAAA
TACCGATGGACCTAACGGTAGTGAAGCAGGAAATTATAGACTGGCCAGGTACAGAAGGCA
GGTTGGCTGGCCAGTGGGTAGAACAGGAGGTGGAGGATAGGCCTGAGGTGAAGGATGAGA
ACGCAGGCGTATTGGAGGTGAAGCAGGAGACGGATAGTAGTTTAGTGGTAAAAGAAGCGA
AGGTGGGTGAACCAGAGGTAAAGGAAGAGAAGGTAAAGGAAGAGGTAATGGACTGGTCAG
AAGTGAAGGAAGAGAAGGATAACTTGGAGATAAAACAGGAGGAGAAGTTTGTTGGTCAAT
GCATAAAAGAGGAATTGATGCATGGAGAGTGTGTAAAAGAAGAGAAGGATTTCCTGAAGA
AAGAAATCGTGGATGATACAAAGGTGAAAGAAGAGCCTCCGATAAATCACCCGGTGGGCT
GCAAGCGGAAACTGGCCATGTCAAGGTGTGAGACTTGTGGTACAGAAGAAGCAAAGTACA
GATGTCCACGTTGTATGCGATATTCCTGCAGTTTGCCCTGTGTAAAGAAACACAAAGCAG
AACTGACATGTAATGGAGTTCGAGATAAAACTGCATACATTTCAATACAACAGTTTACTG
AAATGAATCTCCTAAGTGATTATCGATTTTTGGAAGATGTGGCAAGAACAGCGGACCATA
TTTCTAGAGATGCTTTTTTGAAGAGACCAATAAGCAATAAATATATGTACTTTATGAAAA
ATCGTGCCCGGAGGCAAGGTATTAACTTAAAACTTCTACCCAATGGATTCACCAAGAGGA
AGGAGAATTCAACCTTTTTTGATAAGAAAAAACAACAGTTTTGTTGGCATGTGAAGCTCC
AGTTTCCTCAAAGTCAAGCTGAGTACATAGAAAAAAGAGTACCAGATGATAAAACTATTA
ATGAAATCCTAAAACCTTACATTGATCCTGAAAAGTCTGATCCTGTAATTCGTCAAAGGT
TGAAAGCCTACATTCGCTCTCAGACTGGGGTTCAGATTTTAATGAAGATTGAATATATGC
AGCAAAATTTAGTAAGATATTATGAACTAGATCCTTATAAAAGTCTCCTAGACAATTTGA
GGAACAAAGTGATCATTGAGTATCCAACATTACATGTGGTATTGAAAGGATCCAATAATG
ACATGAAAGTTCTTCACCAAGTGAAGAGTGAATCTACCAAGAACGTTGGCAATGAAAATT
GAGCATTTTTTCTGGAAGAAGAAAGTGAAAACTTCCAGACAACTGCAGCAGACTCTGCAT
TGATGGGCTGTTGGCTGATTGGGGTATTGTCAATGGGTGATTGGAATTTTTTCTTTGTAT
GAAAAATAAGCTTAACTCTTTTAAAAAATGTATTTTATAACCTCTTGAATTAATTGACTT
GTAAGACCCATTTATTCATATTAAGAACTCTCCTTTGCACTTGATCAGCATAGTACTTAT
TAGGCCCTGGCTTTTTAATATGCTTAATTGCTTAATTCCATAAACTGAAAACTTTTTTTT
TCTTTTTTCTTTCTTTTTTTGAGATGGGGTCTTGGAGTGCAAGTGGTATGAGCATAGCTT
CCTCAAATTCCTGGGCTCGAATGGTCCTCTCACTGCAGCCTCCCAACAGGCTGGTACCAC
CACACTCAGCTAAGTTTTTTGTTGTTGTTTTTTTTTGGTAGAGACAGGGTTGCGCTCTTT
CGCCCAGGCTGGTCTCAAATTTGTGGCCTCAAGCAATCCTTCCACCTCAGACTCCAAAGC
ATTGGGATTACAGGCATCAGCCACCACACCTGGCCTTGAACATTTTTTATTTGTTAATTT
CATGCGTGACGAAACCCAAGGATCACCCATGTCAACCACAAAGTTGGCATTCCCTTTAGT
AGAACCTCACTAAACGGAAAGGCTGTACAACGCACCGTCTAGCCACAGGAGAACTAATCT
TCTATCAGTTGCCCTTTCTTCTTTGGAGTTTTTATGTAACTTACCCTTGTGAGACAAGTT
TTCTACTTGAGAAACTCCTAGTACAATGTCTTATACTAGAAGCCTGGATAAATACTATTA
ACTACTGTTTCTTATATTCACTTCAGAAAATCAGTGGCTCCACATTGTTTGAGCCATTAG
TGATAACAAATTTGGATCTACTTACTCAAGTCTTATGAATTCTGTGCCTTTCATCACATT
CCTAGCCCACTCTCATCATTACTGCAGAAGGGTGTTGTGATGACCAGTTTTATACTGTGT
TTTGATATGTCTAGCAATAACTTAAAGAAAAAAAAACCTGGGAAATCTTCAACATGTTAT
TGGAACATATATGTATGTATTAATGTATATACATGGCTTAACTTATACGTTATGGCAGCT
CTGTATACAGTTTGATCTCATGTACTGAAAAAAAATTCTTAATTTTATTGGAGTTTATAC
CACTGTGAAACTGCAATATGACTGTAAGAGAGTAAAAAGATTGTTACATCTATATTGTAT
GTGTGTACTTAATGGTTAAAAAGCAATGATAAAACTGGACATTAATGAAATTGATTTTTA
GTTACAGTTGGAATAAGTTTTTTACCAAAAAGAAACCAGAGACGTTAGTTAAGGAGACTT
AAAAAGATCTGAAATATGAAAAGAGAATGAGAAGATGAGCAGAAGATAAATTTGTGGGAC
ACAAGTATAACTTGGGGTAGAAACTGGAGAAGAGAATCGAAAAACAATAATGCCAGAAGG
ACCCTTGGTATGAAAGTACTAATGGAATGTGATTCATAGAAAGTTCATAGAAAGTGAGTC
CTTGCAACTTGAGAAACATACATACATATATATTTATAATCTCTAAAGCAACATCAGGAA
TCTTCTAATATATGATAAAGAATTTGTGTAGAATTACGTTGTTCACAGTATTATTGGAGA
GACAAATAAGATTTCAAGGAATTCATTTATAATCAAAAGTGAAATGTGTCTTCTTGAAAC
CAGCAAGAAATAGATGAATTGAGTGAAACGTGTTGTTATTAGGAGAAGTGGGATAACGTA
TACAAAAAGAACTTGCGATCTGAATATGATCTGAATATGAGGGTGGATAGGAATTTTTTG
ACAGTGAAATCTGTTATGATGTAGTCTCATTTCCAAGAAAAGTCTTGAGTTCCATCCCCC
CTTCTGAATTTAAATTGAAACCTGGACAGAAAACAAACTATCCTGTAGTTTCCACTGCTC
AGGAGGAAAAAAAGAAATCTATATTATCTAATGCATCTTTGCCATCTTTATTTTCTAGAA
TTCTATTAGACTTTTCAATTATAGGCTATTAGGAAAGAATATAACTCTTAGAATTCCCCT
AAATATAATTATCAACTCATTTGATTAATATGCATATTTTTTCCCGTAAGATTTACAATA
CACGTGTGTTTTAGTGAATTACCAATGGCTTGGAGAGAATGAAATTGGAATAACTAACTG
AAAACCCTAGATGTTTGTAGCATTGAGACCCAATATCTTTTTGGAGGCCCTCTCCATGTT
AGCTTATTGTCAAATTCTGGTGTGTAAACAAACTCCTTGACCCATGTTAAGTTCAGCATC
CTGCATTTTGTTCATGAATCACATTTTAAAAGGAGAAAAGCTCCACCTGGTTTTCTTTAT
TTTTTTAAACAGTGATTTCAAAGAGAAGATAGGCCTTTCATAATTGCTAATTATACATAT
AGGATTAATAGTCATAAATTATAGTAAATAAAACTTGTACCTATTCCTTTTATAAATATG
AATTGGCTAGGCACAGTGGCTCACAGCTGTAATCCCAGCACTTTGGGAGGCTGAGGCGGG
CAGATCACAAGGTCAGGTGTTTGAGACTAGCCTGGCCAACATGGCAAAACCCTGTGTCTA
CTAAAAATACAAAAATTAGCCAGGCGTGGTGGCAGGCACCTGTAATTCCAGCTACTCAGG
AAGCTGGGGCACGAGAATCACTTGAACCCTGGTGGCAGAGTTTGCAGTGAGCTGAGATTG
TTCCACTGCATTCCTGGGCACTGCCTGGGTGACAGAATGAGACTCTGCCTCAAAAAAAAA
AAAAGTTATTAAAAATAGATATTTAAGATTCCAAAATGTAGTTGATCCAGTTTGTTTCCC
TGTAGCAAGTAGTGGGATTTGGGTTTCATGACATATAATTAAAATGTTAATCACATAACT
ATAATGCCAACAATTTTCTTTATACATTTTTGTTTAATTATGTTGACATATACTTTGTGT
TGTACCTTATTTCATGTTACTAAATTTTACATAAAGATGCTGGTCTATTTTTATTTAATC
ATATACTGTTATGGTTTGAATATAGTTTGTTCCTACCAAAACTCATGTTGAAATTAGATT
CCCCATGTGCTAGTGTTGGGAGGCAGAGCCTAATGGAAGGTGTTTGGGTCATGGGGGCAG
ATAGATCCCACATGAATAAACTAATGCCCTCCTACTGGGGTGAGTGAGTTCTCATTCTTG
CTGTCGTGGGAATGGATTAGTTCTCACAAGCAAGGGTTACTAAAGAGTCTGGCTTTCTTG
ATTTTCTCCTTTTTGCCTCCTGCCTTCCCATGTGATCTCTTTGCACATACCTACTCCCCT
TTCACTTTGTACCAAGAGTGGAAGCAACATGAGACCCTCACCAGATACAGCTGCCCAATC
TTGAGCCTTCCAGCCACCAGAATCATGAGCCAAATAAAACTCTTTTTAAAAATAAGTTAC
CCAGTCTTAGATATTCTATTATAGCGACACAAAATGGACTAAGCTGTACTCTGTTGCATT
AAAATGTGTTGTTTATATGCAAGTGACAAAAACTCAAAATAGTGTCAGCATGAAGGGCAG
TTCATTGGCTTATATACAGGGAAGTCCAGGCAATGACTGGGTCCTGGGTCCAAACGTCAA
AAGCAGTCATCTTGCCATCCTACACACTTGGCTCTGATTATTTTCTTCTTTATGGATTGG
TTTTCTTTTCAGATTTTCCCTTTGGGGATATTCTGTATGGGATGAGGAACAGTGAGGTGA
GAGGATGGTGGATAACAGCAATTGACATTTTCAGCTTACCTTAGCATAACAAGGCTGAAA
GCTTTTATAAAGCAAGCTATGTAAAATTTTGGAGAAGTACTTTTATTTTGCCCAGATTGG
ATCACATTCCGTTCCTGAGCTAATCAAGAGAGGAATTCACCCAAAGGAGGGGGAAATTTT
TAGAAGAAAGCCAGAATGTAGGGAGCAGGTGAGGAAAGGTAGTTACTGGGAATACGAAAG
TAACACATTCATTGCACCCTGTTTGAATTTGAGTAGCAAGAAGTTTCTGATTTGTACTAA
CAGAAGGAGTAAAGTTCAGATTTAATCTGCAAGTCTTGATTGTTTTTAACTAGAGATTTT
AATCTCTTCTTCTTATTATTGCTGCTTTGAGTTGCCATTATAGGTTTTTGGATTTTTTTT
TTAATGCCATCCATTTTTATTTGACATCATGTTGTTGCTAGTTTGAGCAGATGCACATAG
CATATGTTTCCATTACCAATTTGGAAATTTTTCCCAGTGGCATCAGCATTTGAGAGATAC
TGATTTTGAAATTAGAGTACTAGGGGAAAATGCTTCAAAAATGAAGACTACTTAAATAAA
AATTGGCTTTAAATAAACCTTTGGGGATCTGTACTTGACTAAAAAGTATTTTCTTTAAAC
TTTGGTCTTTGAAAACTAAAGTGTGTGTGCATGTGTTCATTAAAATGACCTATAACATGA
ACATTTTCCATACTGGAGTGTGATGTACTGTACTCATTTTGAACTTTAGAACCAAATGCA
TCCTTTAGCATTTGATGAGCTGCTATATAATTCTATTTCCAGTTTTATTTTCTTGCCAAA
TAAAGTACCAAAGCTCA

Protein Sequence

>54680 : length: 470
MEFAAENEGKSGGGLHSVAEGVRLSPEPGREGVRDLAGAEEFGGGEEGTGLTGIKEIGDG
EEGSGQRPEEIPMDLTVVKQEIIDWPGTEGRLAGQWVEQEVEDRPEVKDENAGVLEVKQE
TDSSLVVKEAKVGEPEVKEEKVKEEVMDWSEVKEEKDNLEIKQEEKFVGQCIKEELMHGE
CVKEEKDFLKKEIVDDTKVKEEPPINHPVGCKRKLAMSRCETCGTEEAKYRCPRCMRYSC
SLPCVKKHKAELTCNGVRDKTAYISIQQFTEMNLLSDYRFLEDVARTADHISRDAFLKRP
ISNKYMYFMKNRARRQGINLKLLPNGFTKRKENSTFFDKKKQQFCWHVKLQFPQSQAEYI
EKRVPDDKTINEILKPYIDPEKSDPVIRQRLKAYIRSQTGVQILMKIEYMQQNLVRYYEL
DPYKSLLDNLRNKVIIEYPTLHVVLKGSNNDMKVLHQVKSESTKNVGNEN