ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5468

Name

PPARG

Synonym

CIMT1|GLM1|NR1C3|PPARG1|PPARG2|PPARgamma;peroxisome proliferator-activated receptor gamma;PPARG;peroxisome proliferator-activated receptor gamma

Definition

PPAR-gamma|nuclear receptor subfamily 1 group C member 3|peroxisome proliferator-activated nuclear receptor gamma variant 1

Position

3p25

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

role of ppar-gamma coactivators in obesity and thermogenesis;PID BioCarta;100065

Pathway

basic mechanism of action of ppara pparb(d) and pparg and effects on gene expression;PID BioCarta;100064

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

Signaling events mediated by HDAC Class I;PID Curated;200070

Pathway

visceral fat deposits and the metabolic syndrome;PID BioCarta;100004

Pathway

Noncanonical Wnt signaling pathway;PID Curated;200016

Pathway

Gene Expression;Reactome;REACT:71

Pathway

PPAR signaling pathway;KEGG PATHWAY;hsa03320

Pathway

Huntington's disease;KEGG PATHWAY;hsa05016

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Disease

Thyroid cancer;KEGG DISEASE;H00032

Disease

Type 2 diabetes;NHGRI

Disease

Body Weight;GAD

Disease

increased antilipolytic insulin sensitivity;GAD

Disease

metabolic syndrome;GAD

Disease

Obesity, severe;OMIM

Disease

cardiovascular;GAD

Disease

lipids;GAD

Disease

cholesterol, HDL;GAD

Disease

Diabetes, type 2;OMIM

Disease

exercise-mediated changes of insulin resistance;GAD

Disease

edema;GAD

Disease

obesity;GAD

Disease

triglycerides;GAD

Disease

Increased plasma concentrations of total cholesterol;GAD

Disease

Diabetes;KEGG DISEASE

Disease

Essential Hypertension;GAD

Disease

oxidized low-density lipoprotein and cardiolipin autoantibodies;GAD

Disease

Genetic disorders;KEGG DISEASE

Disease

Insulin resistance, severe, digenic;OMIM

Disease

IMMUNE;GAD

Disease

waist circumference;GAD

Disease

glucose;GAD

Disease

Cancers of endocrine organs;KEGG DISEASE

Disease

Familial partial lipodystrophy;KEGG DISEASE;H00420

Disease

PHARMACOGENOMIC;GAD

Disease

birth weight preterm delivery;GAD

Disease

body mass energy metabolism;GAD

Disease

METABOLIC;GAD

Disease

LDL-cholesterol;GAD

Disease

Carotid intimal medial thickness 1;OMIM

Disease

Lipodystrophy, familial partial, type 3;OMIM

Disease

colorectal cancer;GAD

Disease

Bone Mineral Density;GAD

Disease

Insulin Resistance;GAD

Disease

type 2 diabetes;GAD

Disease

diabetes, type 2;GAD

Disease

higher body mass index;GAD

Disease

diabetes, type 1;GAD

Disease

Coronary Artery Disease;GAD

Disease

larger body mass;GAD

Disease

Peripheral Vascular Diseases;GAD

Disease

CARDIOVASCULAR;GAD

Disease

insulin;GAD

Disease

Other genetic disorders;KEGG DISEASE

Disease

NORMALVARIATION;GAD

Disease

higher levels of serum leptin;GAD

Disease

cholesterol, LDL;GAD

Disease

lower lipoprotein lipase activity;GAD

Disease

cardiovascular risk factors;GAD

Disease

Obesity, resistance to;OMIM

Disease

height;GAD

Disease

atherosclerosis, generalized;GAD

Disease

hyperglycemia insulin;GAD

Disease

Glioblastoma, susceptibility to;OMIM

Disease

REPRODUCTION;GAD

Disease

Cancers;KEGG DISEASE

Disease

Metabolic diseases;KEGG DISEASE

Disease

body mass;GAD

Disease

Hypertension/complications*;GAD

Disease

CANCER;GAD

Disease

HDL cholesterol/ BMI;GAD

Disease

Obesity, Morbid;GAD

Disease

Type II diabetes mellitus;KEGG DISEASE;H00409

Disease

cholesterol, total;GAD

Disease

insulin sensitivity and body composition;GAD

Disease

myocardial infarct;GAD

External Links

Links to cell senescence gene database

5468

Links to epithelial mesenchymal transition gene database

5468

Links to ovarian cancer gene database

5468

Links to endometrial cancer gene database

5468

Links to iHOP

5468

Sequence Information

Nucleotide Sequence

>5468 : length: 1939
TGGGCTCCTGCAAGTGCCAGGCGCTGACCACTCCTCCTGGGAGCCTAACTGAGGGGGGTA
GAGGCAGCAGAGGTTAACAGAAATCTCAGGTCCCTTGGTGGAAGGTGGGTGTGTAGTCGT
GGTACTTTACGCCTCGGTGTTTAGGGAGGAGCCTAAGGTAAGGAGTCAGAAACGGGGAGT
AACCGAGCTGCGGCTTTTATATAAGGTCAGTGGTAGGTAAGGAAGGGGCCTTAACCTCTG
CTGGTGACCAGAAGCCTGCATTTCTGCATTCTGCTTAATTCCCTTTCCTTAGAAATGACC
ATGGTTGACACAGAGATGCCATTCTGGCCCACCAACTTTGGGATCAGCTCCGTGGATCTC
TCCGTAATGGAAGACCACTCCCACTCCTTTGATATCAAGCCCTTCACTACTGTTGACTTC
TCCAGCATTTCTACTCCACATTACGAAGACATTCCATTCACAAGAACAGATCCAGTGGTT
GCAGATTACAAGTATGACCTGAAACTTCAAGAGTACCAAAGTGCAATCAAAGTGGAGCCT
GCATCTCCACCTTATTATTCTGAGAAGACTCAGCTCTACAATAAGCCTCATGAAGAGCCT
TCCAACTCCCTCATGGCAATTGAATGTCGTGTCTGTGGAGATAAAGCTTCTGGATTTCAC
TATGGAGTTCATGCTTGTGAAGGATGCAAGGGTTTCTTCCGGAGAACAATCAGATTGAAG
CTTATCTATGACAGATGTGATCTTAACTGTCGGATCCACAAAAAAAGTAGAAATAAATGT
CAGTACTGTCGGTTTCAGAAATGCCTTGCAGTGGGGATGTCTCATAATGCCATCAGGTTT
GGGCGGATGCCACAGGCCGAGAAGGAGAAGCTGTTGGCGGAGATCTCCAGTGATATCGAC
CAGCTGAATCCAGAGTCCGCTGACCTCCGGGCCCTGGCAAAACATTTGTATGACTCATAC
ATAAAGTCCTTCCCGCTGACCAAAGCAAAGGCGAGGGCGATCTTGACAGGAAAGACAACA
GACAAATCACCATTCGTTATCTATGACATGAATTCCTTAATGATGGGAGAAGATAAAATC
AAGTTCAAACACATCACCCCCCTGCAGGAGCAGAGCAAAGAGGTGGCCATCCGCATCTTT
CAGGGCTGCCAGTTTCGCTCCGTGGAGGCTGTGCAGGAGATCACAGAGTATGCCAAAAGC
ATTCCTGGTTTTGTAAATCTTGACTTGAACGACCAAGTAACTCTCCTCAAATATGGAGTC
CACGAGATCATTTACACAATGCTGGCCTCCTTGATGAATAAAGATGGGGTTCTCATATCC
GAGGGCCAAGGCTTCATGACAAGGGAGTTTCTAAAGAGCCTGCGAAAGCCTTTTGGTGAC
TTTATGGAGCCCAAGTTTGAGTTTGCTGTGAAGTTCAATGCACTGGAATTAGATGACAGC
GACTTGGCAATATTTATTGCTGTCATTATTCTCAGTGGAGACCGCCCAGGTTTGCTGAAT
GTGAAGCCCATTGAAGACATTCAAGACAACCTGCTACAAGCCCTGGAGCTCCAGCTGAAG
CTGAACCACCCTGAGTCCTCACAGCTGTTTGCCAAGCTGCTCCAGAAAATGACAGACCTC
AGACAGATTGTCACGGAACACGTGCAGCTACTGCAGGTGATCAAGAAGACGGAGACAGAC
ATGAGTCTTCACCCGCTCCTGCAGGAGATCTACAAGGACTTGTACTAGCAGAGAGTCCTG
AGCCACTGCCAACATTTCCCTTCTTCCAGTTGCACTATTCTGAGGGAAAATCTGACACCT
AAGAAATTTACTGTGAAAAAGCATTTTAAAAAGAAAAGGTTTTAGAATATGATCTATTTT
ATGCATATTGTTTATAAAGACACATTTACAATTTACTTTTAATATTAAAAATTACCATAT
TATGAAATTGCTGATAGTA

Protein Sequence

>5468 : length: 505
MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY