ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

54165

Name

DCUN1D1

Synonym

DCNL1|DCUN1L1|RP42|SCCRO|SCRO|Tes3;DCN1, defective in cullin neddylation 1, domain containing 1;DCUN1D1;DCN1, defective in cullin neddylation 1, domain containing 1

Definition

DCN1-like protein 1|DCUN1 domain-containing protein 1|RP42 homolog|defective in cullin neddylation protein 1-like protein 1|squamous cell carcinoma related oncogene|squamous cell carcinoma-related oncogene

Position

3q26.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

54165

Links to epithelial mesenchymal transition gene database

54165

Links to ovarian cancer gene database

54165

Links to endometrial cancer gene database

54165

Links to iHOP

54165

Sequence Information

Nucleotide Sequence

>54165 : length: 7862
GGTGGTCTTGGACAGTTTCTCATTGCTGGGTCTCCACTCCTAGCTGTTACTGCAAGTCCA
TGCCTCTACCATGAGGGTGGAGGAGTTAAGATCAACAGATCCACATGTACCTTGAGGTGA
CAGACTGGCTCTGAACAAGTTGAAATCATCGCAGAAGGATAAAGTTCGTCAGTTTATGAT
CTTCACACAATCTAGTGAAAAAACAGCAGTAAGTTGTCTTTCTCAAAATGACTGGAAGTT
AGATGTTGCAACAGATAATTTTTTCCAAAATCCTGAACTTTATATACGAGAGAGTGTAAA
AGGATCATTGGACAGGAAGAAGTTAGAACAGCTGTACAATAGATACAAAGACCCTCAAGA
TGAGAATAAAATTGGAATAGATGGCATACAGCAGTTCTGTGATGACCTGGCACTCGATCC
AGCCAGCATTAGTGTGTTGATTATTGCGTGGAAGTTCAGAGCAGCAACACAGTGCGAGTT
CTCCAAACAGGAGTTCATGGATGGCATGACAGAATTAGGATGTGACAGCATAGAAAAACT
AAAGGCCCAGATACCCAAGATGGAACAAGAATTGAAAGAACCAGGACGATTTAAGGATTT
TTACCAGTTTACTTTTAATTTTGCAAAGAATCCAGGACAAAAAGGATTAGATCTAGAAAT
GGCCATTGCCTACTGGAACTTAGTGCTTAATGGAAGATTTAAATTCTTAGACTTATGGAA
TAAATTTTTGTTGGAACATCATAAACGATCAATACCAAAAGACACTTGGAATCTTCTTTT
AGACTTCAGTACGATGATTGCAGATGACATGTCTAATTATGATGAAGAAGGAGCATGGCC
TGTTCTTATTGATGACTTTGTGGAATTTGCACGCCCTCAAATTGCTGGGACAAAAAGTAC
AACAGTGTAGCACTAAAGGAACCTTCTAGAATGTACATAGTCTGTACAATAAATACAACA
GAAAATTGCACAGTCAATTTCTGCTGGCTGGACTGAACTGAAGATCAATCCTCACAATTC
AGACTGAGGGTTGAGACAAAACTTTAAGGATACATCTTGGACCATATCGTATTTCATTCT
TCTAATGGTGGTTTGGGCTTGTCTTCTAGTCTGGGCCGCTCTAAACATTTATAATTCCAA
CATTGTGGATTTCATCTTATATCTGTGGACCATCCTAGTTTATTCTCCCATAAGTCTTAG
AAGCTTTATGGTGATTATTTTGAGGTTTTCATTCTCGCATAAAGCACAATGCTGTCTTCA
TCAGAAAACAGTTGGCATAAGAATTAAACATATGAACATCACAAAACAATTTATAAAAAC
TTCTTAAATATACGCTTTGGGCTAGTTGCAAAGACTATGCTAATAGCACTTCCAGTGAGA
GTGATATATTTAAGTGTACTGGATCTGGAATGGTGTTTTGGTTTGGGGGGAATTTTTTTT
TTTTCCTGGCAAATCACATGTGTTGTTGATGTGAGTATCTGATGAAAAAACAATGTCAGA
ATAACCGACATGAAAATTTTTTAGGATAACTTGGTGCCTACCTGAAAAATGTATTGTGTT
TTAGACTCTTGATTTCAAAAGGTTCCACAGAACTAGTCTGCGCTTACCTTACCCATGTTT
ATATATAGCTGTCCTACAGGGAGCTTTTATTTAGAAAATGTCTGCATAATGTTAGATTCT
TCTCCTGTCTACATTATGCACTACATAATTGGACTTCATTATGCTTTTGAAATGCTTATC
TGCCTGTCACATAAGTTAAACTATTTAATTTGTTTTGAATGTTTTGGATTGCTACACAAT
ACAATATTCTAAATTTAGGCATGAGGGTTTTTTTGTTTTGTTTTTACTTTTTTTTTGTCA
TCGCACTATGGAACACAAATGGAATTCTCTTAATTTATAAGAAGATAGTTGCAGTTAAAT
TTTGAAAATGGTTGTAATGAGCCATGAAGTTCAATCTTTATAATATAGGTACTGCTCTTT
CAGACAAATAGTCCATTTTCGATGACTTATTATTTTGTTGAAATTGCTTTAACTGCTAAT
CACTGTGGTTGCCAAATATTTACTTCAGGAGCAAAGATTTTCAAACAAGCATACACGATG
CAAAATACCAATCTGGCTTCTAGTCTCTTTACTGTTTTCGTTTCACTCAGATTAGCTCAG
TTTTCTCATCAAAGCAGAATGCTATCTTGTATGTATTTTTTTCATTACAAGCCCCATGAG
CTGCTTTTATGCTGAAAATGGTCATTTCCCTGTTCACTTACTGACATGTGAAGAAGGGTT
TCTTGCTTTCTTAAACATTTCCGTAAGGCAGGCTAGAAATGTAATACTTCAAATGTTTGA
TGATTATGGTCTTTTGATAGGAATAGATTCTGCTTGGGATATATATCCAGGCACTCTCTA
AGGTCTAGGGTTGATATTAACAAAGGAATGTACTTAGAATAGCAGTACATTTTATGCAAA
TATGGAAATTATTTTAAGAAACAATGACATATCAAAACTGCTTTTTACATGATTTTGAAA
TAGACTAGAAAGCTTTCCCTATAGACATATTAATATTCCAATCATAACTTTAATTCAAGA
ATGCAGTTTTACCAAAAGAAAAATTTGAAAATTTCTATTCAGGCTACTGGAATTGGTTAT
TAAAAGAAAAAGGAAAAAGAAGAATCTTGCTGCTTTCAGTATTTCCTGATTTTTTTGTAA
ATATAAAGAGGAACTTCAATTATGAAAAATTTTTAAAAGATATATATATCTATATATCTA
TATATATGTACTGTTTTGTTTCCTGTCTTGAAGATTTTGAGTTATGGTTATTGGTTTCAG
ATTGATTAATTCACATATGCTGTGTTTTGAAATGAGATCCCATTAGCTTTTTTTTTTTTT
TTTTTTTTTCAATATAAAGTGTTTTCTTTAAAAGTCATATTGGTTCGTGGCCTAGTGCCT
TGGATTTTACATATTTTTCTTTTTAAATGCAAAACCTTTTCAACAAAATAGTGTTTGTCA
TCAGGTTGGTACTAAACATTTATAATTACTGTGTAATTATAAACAAAAATACATAAAGCT
TTGAATATAATTATGTAGCATAAAAGTTAAGGTTGTTCACTATGATGGCATCTTAGAATT
AAACAAAACTTTTACTAGGGCTGAAAAGAGAAGACTGATTTAATGTGGTGTGATTATTCT
GAAGATAAATGTCTGGCTACAGGGAATATTTTGTACTAAAAAATGATTACACATATGGCT
GTGTGTGTTTGAGTCTGTGTCTGTGAGAGAGCCAGAGAGAGTGAGAGAGATTGACAGAGA
AAGGGAGAGACACACACACGCCCCTTGAATTGCTTTAACTCCTAAGTGTTTCAGTCCTCA
TTCCGGTAAACTCCCCATGCTGATTCTTTGTTTTAAACTGAACCATAGGTACAGTTTCCT
TTTTGCCAAATGTCAAAACAGGTACAAATTTTAAAATGTAATGCTTTTTAAATAGAAAAA
TGTATAAAATTAGAAGTGCCCACATATAAAAAATACTTGAGATGAAGATTATCTTTAGTG
AATATCATCTGCATATCTCTGTAAGTTCAATTGTGTTTCTTACAGTCCCTGTCATATTAC
CAACAGAGGCAATAAAAGCTGCAGTGAAATTGCCATGACTAAATCTTTTCACATATTTCA
GTGTATTTTTTTTATAGATTTAAAATATACCTGAAAACTTTTCTAGGAAGAATAATTATT
CATGGAAAGAGCATTGTAATGGCATGTTTTGGGGAGAAAAGACATGCCAAGTCTTGTTTA
CTACATTTAAGATGTTTACAACTATACTGGGCTGCTTTATTAACAATACTGTACTTGCAT
AATATGGCATTATAAGTACATGTCCTTCCTTAGACTTTTAAAAAGTTTTAATGAGAGAAA
GTAAATTTACTCAACAAAATAACATGAGAAATCCTTTACGTAATATCTTTACTGGGGAAT
TCTTATTTAAGCAAGGTACACTATTTTTTCCTCAGACTTAAATGAATGAAGTGTTCATTT
ATTTTTTATTTGATGATAATCAAGAAGTGAGTAGTAGTAGCTAACTTAATGTACACTTTG
CTTAGGTTTTTAAACATGTTACTATTAAGACTACGTATTGTAAACCTTCTGTAATTTTCA
CATATGAATGACAGGAGAAAGTTAAACCTAATCGAAGGAGTTTTGGAATAAAAAAGTGGT
GCTGGGGAAATTCACCATGGTTCACAAAGTATGCCTTTGTAAAACTGAATCAACTTTTAG
CAAGAATTAATTTATGTAGTTTTAAATGTTAAATTGTGTATATTTAACAGAAAATACTTA
TCTGGCACCTCAGCAGTTTTAATGTTACCTTATACTTTTAACAGTATGATTTATATTGAA
TACTTAGATGTTTTCATAAGATTTTATCAAATTTGATAATGTAATGATAAAATGTTTTTT
TAAATGTGAACTATTTAACATATAAATGGGGACACAAAACCTGAATTGTGATTTCTACAT
AATGTGATAATTAGGGTTCAAATTATGACTCATCATTTAATTGATTATAAATGAGTATAT
TTCTGAACTCTTTATTGCCTCCATTTTTACAATCATAATATAGCAATAATTTCTATTTTT
ATTTCATAGGACTGTGGTGAAGTTATTTATCATGACACCTTTATCTTTGATTTCTGAGGG
AAAGGGGTGTATATTTTGTAGTTAAGATAAATGAGAAAGTTCCTAATAGTACAAATGCCC
TTTTCCAGGTTTATCTTTGCTATTTGTTGCCATTTTTCTTAAATATTTGCTTTATTTGTA
CCCGATTTCTGGAGGCAAATAGTGCTGTTTTTTCAAACTCATAATATAGTTACATAAATG
ATTTTATCAGAGCATTCTTGCTATCTTATTTTCTTTCCTACCTGTTGAGTAAGTAGCATT
TCTTGCTCACCAACTCATTTATTTGACTAGGTTCAGTGTTTCCTATTAATGTGTTTTTTT
ATTTTCCTTTGGTTGATTTTGAAAAATCTGTCACAAATAAGGAAGTTATGGTAAAAGATG
CACAGCCTTTGTAGTTAGTGGAATTCTCAATAAGTAATGTCTTTATGGAGTTTTAAAGGG
AAATTATTTAAAGGGAATCATGTTATAGTTGTCCATTTTTTAAATTGAGATTTTAAAAGT
GTTTTTAAGTATAGCCCAATTTTCTATTTACTTACAAGTGCTTCATGATTGTTTTCTTTT
TTATTTTTTGCCATCATGCTGTGCAGAAATCATAATGTAGCTTGTAATACTTCAGAGCAT
TGGTCTTGAAGCTGTAACTTGGGGCTGCTGTCCTTCATGAGGTAGGGCCATAGCAGGCAG
GCCCTTTCCCACTTCCTTTATGGCATTCTACTTTTATCTGTTGTAGGCTGTTAGTGTTTC
ATATTCGATTTGGTTTGGGGAAAAATACTCAGTTAAAAAAATTTTTTTTAATGATTGGCT
TTAGAGGGACTGTTACCTCTTTGGCATATCTGTCAGCGGAATGGAAAGAAATGGAGTCAG
ACTGAAATTCATGCCAGCTTAATCACTGAAGGCAGCACTGCTTTGAAAAGAAGAATTTTC
AACCCACATCGTAAAAACAAAGCCTGATTGGAAACAATGAAGTGTTTGAAACTTAGGGGC
AGCATGTAAGTGGCTTAATGAGCAAACAAACGGAACATACTCATTTTATATTTAAAAAGT
ACATATATATTCAAATGCATGTTCATATGAATATTATAATTTTATTTCAGGTTATGAAAT
ATTCTGAGAAAACCTTATATCTGATGGAAAACTTGGGCAATACCCAATACGAAGCAAGAG
ATTTTTACAAAAAGAAATACTATAGGGCATAAGGTTGGGGGAAGACCAATTAATGAAATG
GCTAAGGGACAATGCTAATTAAATCGTTAACAGTGATTTTGTCACATAATTACATGACTT
ATAGCTAAAAGAGCAATATTTAATCAGTAAGATTTAGAGATGGGTGTACTTGGAATCCTT
TGAAAGCAGCGTGTTTAGTTTTCAAGCAAATGCTAATGTTCTTAATCCTAATAGTATATT
AGACTTCGTTGTGTTGAATATATCAAATGAACGAACTATGAACCAGAGCTTTAAAATAGT
GATTTGTAAGACTTTGTTACAATGGTACTTAAAAAATTGCTTTGTATAATTTACACACTG
TAAAATTCACCCATTGTACATGTACAATTAATTGTTTTTAGTAAACTTAAGAGTTGTGCA
GTCCAATTTTAGAACATGTCCATCAGCCCCCAAAATTTACTCCTGCTGCTCTGCGGTTAA
TTTGCTCCTGCCTCCAGCCCCACGCAGCCACACTGATCTGCTTTCTGTACAGATTTACCC
TTTCTAGAAATTTCACAGAGGTAGAATCATGCAGTTAGTCTTTTATATCTGGCATCTTTC
ACTTAGCATGTTTTTGAGGTTCATCCATGTTGCAGCTTATACCTGCGTGTAGTTCCTTTA
GTTGCTGACTTAGTGTTCACTGTTTGGATATACCACATTTTGTTTATCCATTCACCAGTT
GATAGACATTTGGCTGGCCTACAATTAGTTTTTTTAAATTGCGAATAATAATGCTATGAA
CATTCATAAATGTCTTTGTGTGGACATGTTTTCATCTCAGATTCCTAGTTGTGGAATTGT
CAGGTTGTGTGGTAAATTTATACCTAACGTTTTTAAAAAAACTGCTGAACTTTTTCCAAA
GTGGCTGTACTTCTAGAACTATTCCTGCCACAGTGCATGCGGACTGCCGTGTCTGCACAT
CCTTGCCAATACTTGTCTTTTTTATTGCAGCCATCCTGGCGGGTATTTACTTTATGTGTG
TGAGTTATACCTAGGCATCCCAACTCGTGTATCGATTGGATGTGCAGTTTGAGTGAGTTT
CAAGTGGCCTCAGCGATTGCTGTAAAATTAGTTACTCTAGTAGACATGTACTCTCTTGGA
GGTAGTATTTTCTGTAGTCAGTGAGGGTAATAATAATACTTCCAGTGGGGGTTCCAGTCC
CTCAGTGATCTCTGGTGAGAAGAAATGTGTCAGCGAAGAGTGGTGCTGATGGCTGGTGCT
TTGGCTCTGTTATTGTTTGTACCAAGGTTGATACAGCTACTCGACTAGCCTATGACTGAC
TGGTGGTGGTAATTAAACTTTGTACAGATTACTGTGTGCAGATAGTTACTGTCTTAATAT
TAAGTTTCCCAGAGATTTTACTTTTGAGATAGCTGAGAATTAACGACTCTTGGAATTTAT
AAAAATTTAGTTGATACCATTTAGTTGCTGCCAGCTGCCTGTGTTCTTATACATAGGAGA
CATCGGAGTGAGTGCTTTTTAAAAAATTAATGGCGTATGTCAGGTATATGTAAAAGGACA
ATTGCATAATGAACTCATGTTAACATGATCAATCCATGGCCAATCTTGATTTATCTAAAT
GCCATTCATCTTTGAACCCCTATTTATTTTGAAGCAAATCCCAGATAGCAAATCATTTCA
TTTGTAAATATTTCAATATGTATGTCTAAAAGATAAGGACTGTTAAATAAAACCACAATT
CTGTTGTTAGACTTAACTGTTAACAGTTTGTTAGTGTTAATAACTACCCAGCAGTGTTCA
AGTTGTGCCTTTTTTTTTTTTTTTCCAATTCAAGTCAGGATTCAAATAAGATTCCTACAT
TGCATACATCTCAAATGTCCTACCCAGTGGATCCCCACACTCTCCACTCTTTGGCTTCAA
ATTCATTTTTTTGAAAAAACAATGATTGCTTTAGCACTTTAAATTTCTATGCAATTTCAA
ATGTAAGGTGAAATTTTGATGTACTTAATAAAAAAATTCTAACGAAAAAAAAAAAAAAAA
AA

Protein Sequence

>54165 : length: 280
MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSL
DRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQ
EFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIA
YWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEEGLLPLW
HICQRNGKKWSQTEIHASLITEGSTALKRRIFNPHRKNKA