ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

541466

Name

CT45A1

Synonym

CT45|CT45-1|CT45.1;cancer/testis antigen family 45, member A1;CT45A1;cancer/testis antigen family 45, member A1

Definition

cancer/testis antigen 45-1|cancer/testis antigen 45A1|cancer/testis antigen CT45-1|cancer/testis antigen family 45 member A1

Position

Xq26.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

541466

Links to epithelial mesenchymal transition gene database

541466

Links to ovarian cancer gene database

541466

Links to endometrial cancer gene database

541466

Links to iHOP

541466

Sequence Information

Nucleotide Sequence

>541466 : length: 1027
AGTGTTCGGCTGGGCCAGCACACTGTGGCTGGCTGCTTCCCTTCCTTCCATCCCCTTTGG
ACCAAACGGGATCGGTGCTTCTGGTGAGACGCCTCCCCATGCACATCACTCCCAGGTGCC
CTAGGGGGCACATTTCCCACAACTCCCAGAGGGCAGGTTTCTAGAAAGTGCCACCAGTGG
GGAGGCGCCACAACTTCACTGCCATTTTGTGAGGTGCTGCTGTCTCTCCTCCAGCAAGGA
AACAATGACCGATAAAACAGAGAAGGTGGCTGTAGATCCTGAAACTGTGTTTAAACGTCC
CAGGGAATGTGACAGTCCTTCGTATCAGAAAAGGCAGAGGATGGCCCTGTTGGCAAGGAA
ACAAGGAGCAGGAGACAGCCTTATTGCAGGCTCTGCCATGTCCAAAGCAAAGAAGCTTAT
GACAGGACATGCTATTCCACCCAGCCAATTGGATTCTCAGATTGATGACTTCACTGGTTT
CAGCAAAGATAGGATGATGCAGAAACCTGGTAGCAATGCACCTGTGGGAGGAAACGTTAC
CAGCAGTTTCTCTGGAGATGACCTAGAATGCAGAGAAACAGCCTCCTCTCCCAAAAGCCA
ACGAGAAATTAATGCTGATATAAAACGTAAATTAGTGAAGGAACTCCGATGCGTTGGACA
AAAATATGAAAAAATCTTCGAAATGCTTGAAGGAGTGCAAGGACCTACTGCAGTCAGGAA
GCGATTTTTTGAATCCATCATCAAGGAAGCAGCAAGATGTATGAGACGAGACTTTGTTAA
GCACCTTAAGAAGAAACTGAAACGTATGATTTGAGAATACTTGTCCCTGGAGGATTATCA
CACCCCAAATGCATAATCTCGTTAATGATTGAGGAGAGAAAAGGATCAGATTGCTGTTTT
CTACAATGGAGCAGGATATTGCTGAAGTCTCCTGGCATATGTTACCGAATCAAATAGCCT
TCCAGAGGCTAAGAAATTTCTGTTAGTAAAAGATGTTCTTTTTCCCAAAGCATTTTATTT
GAAAGGA

Protein Sequence

>541466 : length: 189
MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMT
GHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQR
EINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKH
LKKKLKRMI