ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5371

Name

PML

Synonym

MYL|PP8675|RNF71|TRIM19;promyelocytic leukemia;PML;promyelocytic leukemia

Definition

RING finger protein 71|probable transcription factor PML|promyelocytic leukemia protein|promyelocytic leukemia, inducer of|protein PML|tripartite motif protein TRIM19|tripartite motif-containing protein 19

Position

15q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

p53 pathway;PANTHER;P00059

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

regulation of transcriptional activity by pml;PID BioCarta;100067

Pathway

C-MYC pathway;PID Curated;200093

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

mTOR signaling pathway;PID Curated;200080

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Height;NHGRI

Disease

Cancers;KEGG DISEASE

Disease

Gallbaldder cancer;FunDO

Disease

Prostate cancer;FunDO

Disease

Acute myeloid leukemia (AML);KEGG DISEASE;H00003

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Rheumatoid arthritis;FunDO

Disease

Cytomegalovirus infection;FunDO

Disease

Leukemia;FunDO

Disease

Neuroblastoma;FunDO

Disease

Leukemia, acute promyelocytic, PML/RARA type;OMIM

Disease

Breast cancer;FunDO

Disease

Leukoencephalopathy;FunDO

Disease

Liver cancer;FunDO

External Links

Links to cell senescence gene database

5371

Links to epithelial mesenchymal transition gene database

5371

Links to ovarian cancer gene database

5371

Links to endometrial cancer gene database

5371

Links to iHOP

5371

Sequence Information

Nucleotide Sequence

>5371 : length: 5600
CTCTCCAGAGGCGGGCCCTGAGCCGGCACCTCCCCTTTCGGACAGCTCAAGGGACTCAGC
CAACTGGCTCACGCCTCCCCTTCAGCTTCTCTTCACGCACTCCAAGATCTAAACCGAGAA
TCGAAACTAAGCTGGGGTCCATGGAGCCTGCACCCGCCCGATCTCCGAGGCCCCAGCAGG
ACCCCGCCCGGCCCCAGGAGCCCACCATGCCTCCCCCCGAGACCCCCTCTGAAGGCCGCC
AGCCCAGCCCCAGCCCCAGCCCTACAGAGCGAGCCCCCGCTTCGGAGGAGGAGTTCCAGT
TTCTGCGCTGCCAGCAATGCCAGGCGGAAGCCAAGTGCCCGAAGCTGCTGCCTTGTCTGC
ACACGCTGTGCTCAGGATGCCTGGAGGCGTCGGGCATGCAGTGCCCCATCTGCCAGGCGC
CCTGGCCCCTAGGTGCAGACACACCCGCCCTGGATAACGTCTTTTTCGAGAGTCTGCAGC
GGCGCCTGTCGGTGTACCGGCAGATTGTGGATGCGCAGGCTGTGTGCACCCGCTGCAAAG
AGTCGGCCGACTTCTGGTGCTTTGAGTGCGAGCAGCTCCTCTGCGCCAAGTGCTTCGAGG
CACACCAGTGGTTCCTCAAGCACGAGGCCCGGCCCCTAGCAGAGCTGCGCAACCAGTCGG
TGCGTGAGTTCCTGGACGGCACCCGCAAGACCAACAACATCTTCTGCTCCAACCCCAACC
ACCGCACCCCTACGCTGACCAGCATCTACTGCCGAGGATGTTCCAAGCCGCTGTGCTGCT
CGTGCGCGCTCCTTGACAGCAGCCACAGTGAGCTCAAGTGCGACATCAGCGCAGAGATCC
AGCAGCGACAGGAGGAGCTGGACGCCATGACGCAGGCGCTGCAGGAGCAGGATAGTGCCT
TTGGCGCGGTTCACGCGCAGATGCACGCGGCCGTCGGCCAGCTGGGCCGCGCGCGTGCCG
AGACCGAGGAGCTGATCCGCGAGCGCGTGCGCCAGGTGGTAGCTCACGTGCGGGCTCAGG
AGCGCGAGCTGCTGGAGGCTGTGGACGCGCGGTACCAGCGCGACTACGAGGAGATGGCCA
GTCGGCTGGGCCGCCTGGATGCTGTGCTGCAGCGCATCCGCACGGGCAGCGCGCTGGTGC
AGAGGATGAAGTGCTACGCCTCGGACCAGGAGGTGCTGGACATGCACGGTTTCCTGCGCC
AGGCGCTCTGCCGCCTGCGCCAGGAGGAGCCCCAGAGCCTGCAAGCTGCCGTGCGCACCG
ATGGCTTCGACGAGTTCAAGGTGCGCCTGCAGGACCTCAGCTCTTGCATCACCCAGGGGA
AAGATGCAGCTGTATCCAAGAAAGCCAGCCCAGAGGCTGCCAGCACTCCCAGGGACCCTA
TTGACGTTGACCTGCCCGAGGAGGCAGAGAGAGTGAAGGCCCAGGTTCAGGCCCTGGGGC
TGGCTGAAGCCCAGCCTATGGCTGTGGTACAGTCAGTGCCCGGGGCACACCCCGTGCCAG
TGTACGCCTTCTCCATCAAAGGCCCTTCCTATGGAGAGGATGTCTCCAATACAACGACAG
CCCAGAAGAGGAAGTGCAGCCAGACCCAGTGCCCCAGGAAGGTCATCAAGATGGAGTCTG
AGGAGGGGAAGGAGGCAAGGTTGGCTCGGAGCTCCCCGGAGCAGCCCAGGCCCAGCACCT
CCAAGGCAGTCTCACCACCCCACCTGGATGGACCGCCTAGCCCCAGGAGCCCCGTCATAG
GAAGTGAGGTCTTCCTGCCCAACAGCAACCACGTGGCCAGTGGCGCCGGGGAGGCAGAGG
AACGCGTTGTGGTGATCAGCAGCTCGGAAGACTCAGATGCCGAAAACTCGTCCTCCCGAG
AGCTGGATGACAGCAGCAGTGAGTCCAGTGACCTCCAGCTGGAAGGCCCCAGCACCCTCA
GGGTCCTGGACGAGAACCTTGCTGACCCCCAAGCAGAAGACAGACCTCTGGTTTTCTTTG
ACCTCAAGATTGACAATGAAACCCAGAAGATTAGCCAGCTGGCTGCGGTGAACCGGGAAA
GCAAGTTCCGCGTGGTCATCCAGCCTGAAGCCTTCTTCAGCATCTACTCCAAGGCCGTGT
CCCTGGAGGTGGGGCTGCAGCACTTCCTCAGCTTTCTGAGCTCCATGCGCCGCCCTATCT
TGGCCTGCTACAAGCTGTGGGGGCCTGGCCTCCCAAACTTCTTCCGGGCCCTGGAGGACA
TTAACAGGCTGTGGGAATTCCAGGAGGCCATCTCGGGCTTCCTGGCTGCCCTGCCTCTCA
TCCGGGAGCGTGTGCCCGGGGCCAGCAGCTTCAAACTCAAGAACCTGGCCCAGACCTACC
TGGCGAGAAACATGAGCGAGCGCAGCGCCATGGCTGCCGTGCTGGCCATGCGTGACCTGT
GCCGCCTCCTCGAGGTCTCCCCGGGCCCCCAGCTGGCCCAGCATGTCTACCCCTTCAGTA
GCCTGCAGTGCTTTGCCTCCCTGCAGCCCCTGGTGCAGGCAGCTGTGCTGCCCCGGGCTG
AGGCCCGCCTCCTGGCCCTACACAACGTGAGCTTCATGGAGCTGCTGAGTGCACACCGCC
GTGACCGGCAGGGGGGCCTGAAGAAGTACAGCCGCTATCTAAGCCTGCAGACCACCACGT
TGCCCCCTGCCCAGCCTGCTTTCAACCTGCAGGCTCTGGGCACCTACTTTGAAGGCCTGT
TGGAGGGTCCGGCGCTGGCACGGGCAGAAGGAGTCTCCACCCCACTTGCTGGCCGTGGCT
TGGCAGAGAGGGCCTCCCAGCAGAGCTGAGAGGAGGGGGTGACCAGCTTGGAGTCTCTGG
TGGGCAGAGAGGGATGGGGTCCCTGAGCCAGGCCCCACCCATCACAGCATTCCCAGGTCC
TGGTACCCAGCCCTCAGTTGTCATTTGGTTCAGAATCAGTTCCCTTTCTCTGGGACCAAA
TTTCCCTTCTCTAAACATCCTACAGAGAAGGTTCCAAAGCTGAGCACCCATCACCCTAGG
TGTGCACCAGACTCCTATTAGCCCCTCCTTCCAGGAGCTAGAACCAGGGAGGTCCTGAGT
GAGGAAGGCATGACCTCTGGGCTCTCTAGGTGGCCCTGGTCTTGCCCCATCCATCCCACC
TGCCACTACCTTGGGTGTCCTTACAGCTCTGCCCTGACCCCAGCCCCTGCCCCTGGACAC
CTGCTGACAGCTCCCACACAGAACAGTCTGAGGTGATGCTGGCTACAGCCCTGGCAGCCC
ATGGCAACTCAAAGTGCCTTCCAAACCAAACTGCCCCTCATGAGGTTAGGGTCCCCCACC
CTCCACCTGCCCAGAGGCCAACTCTGTTCCCTTCTCCTTTCATCCCAGAGGGGCCTCATC
AGCAAAGACAGAAACTGATGTTCCATGCATGTCCCTGCTTCCAAAGCCTGACCTTCCAAA
GCTTGCTTCCTTCCTCCTGGCTGCACAGACACCTCTGCTTGGCCACAGCTTTGCTCTTTG
GTCCTCAGGCCACCAGACCCCTCACAGCATGGCCCTTGGCTCTTCCTGCACTGCCCTCAC
CCTCAGCCGTCCCAAGGAGTGCCCAGCACTACTCAGCATGTAGTCCAGGACCTGCGGCAT
CAGCATCCCCTGGGAGCTTCTTAGAAATGCAGACCTGTGGGCTCTACCACAGGCCTCTGG
AATCAGAATCTTCAGGGTGGGGCCCAGCAGTCTGTGTTTTAACAGGTTCTCCCGGTGATG
CTGGTGCATGCTCAAGTTTGAGAACCGCTGCTCTCATAGACTGCTCCTCCAAGGGGAAGC
AGTGTGGAACAGCAGAGAAAGTCCCGTCCCTATCTCTGACTGTGCAGTGAGTGTGGCCTA
GGAACAGGTCCCTTCCTAAGCTCTAGTGTCCCCATCTGTAAAATGGGCTGATTGGCCTCC
ACGGTCAGAGCGGCCATCTGGCTGTGCCATCCTGCATTTTTAGGAATGGAAAGCAGGCCT
CTGAGGCAGTGGACAGGAAGACTTCTCATCCTTGAATTCTAGCTCCCATTCCAAACTGTT
AGTCCCCAACCTTGTGGTCACATCAGAGGTCAACAGCAGAACAGAGGCAGGTCAGGGTTG
TCCGCTCTGATTAGCAGAACGACAGCCCCTTCCTCCTCCTCCCTCCTTCCCATCCCTACT
CATTAGCTCCCTGCTCCTGGGATGCTTCCCAAGCAGCCCAGGCCTCTAGCCTCCATGGCT
GATGACCTCAGCTTTCACACTGGTGAAGTCTGTGTACCCATACTGCAGCCCCATCCCATG
GGGCCCCTGAAGACCCACTGAGGAATTCCGTAGGGTCTTGTTCCCACGACCGGAGTGCTG
GCTCTCACAGTGAATTTTGATGCATTTAAAATAAGATTCTGATGCCAGACTGTTAAAACA
GGCGCTGGTTCTGAAGCACCGATGGAAACAGATTGATGCAGATGGAAGGAGGAAGGGAGA
CTGGGCCCACTGATTTCCAGCCCCACCATGTGTGCTGTTTTCAGATGTGATTGAGGGGTG
TTCTGCCCTGCCTCCACTGTCACAGCCTTTAATAAAGATGTGAATCTTGAAAGCCTGATG
CTCCAATCACAGACTCTGCTCAGCATCCCCAGAGGAACCACTGAGAAGCCTTTTGCCTGG
ATAGGAGGGGGCTCTCCCAGGCATAGGCTTGTGGCCACTTGCCCAGCACAACTGTGTTTT
GTGGGGCGTCTTTTAGGACTTAGCAGAGCTGAGAGCCCTTTGTTGCTCAATGCTGTGAGC
CTTAAGCATGTGAATCCCCCCACATGACAAGTGGGGAGACCCAGGGTAGGCTTTCCTTTG
GATCATCTCCAAATGGGAGTGCCATGTGGCAGGAAAGAAGCACCGATTTCAAGAATTACT
TCCTAGAGAAAGTCAGGAACTAGAGACCAGAGTCTGCAGGAACTTTGCCACTGCCCTTCA
CTGGCTAATCCTGTACTTCTCTCTGTGTTCCTTGAGTGACAGGTGGTAAAACCCTTAAAA
AGGGAGGTGTGGGAGGCCCAGGACTTTGGTAACAGGTGATGAATGTGTTGTCTTGGCCAT
CACAGGTGGAGCTTCAGTTAGTACCCGAGGGATTCCCCTGGCACAAGCATTATAGGAATT
AGTCCACCACTGGCGTGGGTGAGCAGCCAGGTAATGGGAATTGATCAGTGCCACCACCCT
TGACCCCAACTACCATCCCAGATGCCCAGATTCCAGTCCTGGAGTTTTATTCTCTCAGCT
TGATCCTTTGACCAAGAAGATCCAGTCCCAATATGTCACCTGTGCTTCATCTTTGGACTA
TATCTCAGGTGTTTACGTGTCAACTAATGGGAGCTTACTGGGTTAGAAGTCAGGACACTG
AGTTTCAATCCTCACTTAGTAGTCTGTGGCCCTCTTTGGCACATTAACCTCCCTCCTTGA
TCCTCAGGCTGCACCTCTGGCAAATGGGAGAATGCGGCTCCTTTTGACTTCAAGGGATCT
TTGTGGGAACCAATGAGAAAATGTGTGTGAAGATAGCTTTTTGGTATATTTTAAAAGTGC
ACAAATTTAAGATCTTACTGCTTTATAAAGTGCTTTATGAATTATAGGAAAATAAACACA
TTTTAGATCTTAGAAAAAAA

Protein Sequence

>5371 : length: 882
MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQC
QAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYR
QIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDG
TRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEEL
DAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEA
VDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLR
QEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE
EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCS
QTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLP
NSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENL
ADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQ
HFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPG
ASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFAS
LQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPA
FNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS