ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5364

Name

PLXNB1

Synonym

PLEXIN-B1|PLXN5|SEP;plexin B1;PLXNB1;plexin B1

Definition

plexin 5|plexin-B1|semaphorin receptor SEP

Position

3p21.31

Gene Type

protein-coding

Pathways and Diseases

Pathway

G alpha (12/13) signalling events;PID Reactome;500437

Pathway

Sema4D mediated inhibition of cell attachment and migration;PID Reactome;500073

Pathway

Axon guidance mediated by semaphorins;PANTHER;P00007

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Sema4D induced cell migration and growth-cone collapse;PID Reactome;500074

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Axon guidance;Reactome;REACT:18266

Disease

Renal Cell cancer;FunDO

Disease

Embryoma;FunDO

External Links

Links to cell senescence gene database

5364

Links to epithelial mesenchymal transition gene database

5364

Links to ovarian cancer gene database

5364

Links to endometrial cancer gene database

5364

Links to iHOP

5364

Sequence Information

Nucleotide Sequence

>5364 : length: 10757
GGGGACCCTCCTCTCCACACACAGACATATTAAGTGGGTGATCGATGAGCGCCTTGGGTC
ATCGCAGGTGCCTGGTAAATGGTGGATCTCCCCACCCCTCCTCAACACACAGAAAACAGG
GCGGGCAGCGGGCACCACTGCACTGTCAATGAATAACTCACCTCTGTAGTGAACCCTGGG
AGCTGAGCAGGAGGGTGAAACGGGAAGGCCGGTTTCCCACTAACTGGCAGGCAAGGCAAA
TGTGGGCTGTCCTATGGCCCCTCTGCAGGTGCGGAATGGCGGGGTTTGTGAGCCCCTTTT
GTTGTCGAGGACAGCTCCACGGGGGTCCGGGAGGTGCTTGCTCTACAGACAGAAGTTGGG
CAGTCTTGCGCCCCCTGAAAAGGTTCAGAGTAGGGTGGCCCCAGAAGAGACTCCAGGGCA
TGTGTGGGGGAGCACTGGGCACAGGCAGAGTTAGGCTTTGGCTGTGAGTCTGAGCAGGGC
CTCAGATATTGGGAATGGGCAGGAGATCCTGGCTGTGTAAGTTGGGGATGTGAGGTCTGG
TTCTAGATCAGCCTTTTCAGTCTGCCCTGGCCTGGTCATTAATAAAAGTGGGGCCAATGT
GTTCCCTTTGAGAGACCAAGTGGCTTGGAGGGATTGTGGGCCCCCTATCTCCCCTACTTG
TTGGGTTTTCTTGGGTGTGAAATGGGGGTTCGTTCACCATACAGGGAGCATCTGGTCTGT
GCTGAAGTCTGTGTAAGTTGCTGGGGCCTCTGAATCAGAAGCCATACTCCCTGCCTTCAA
GGAGCTTCAAGTCCAGAGTAGGAGGGTGGAACAGGGAGAAAGGTGACCCTGGTTGGCATC
ACTAATGCCAGGCACACACTGTTTCATGTTTACTGGTCAGAGCAATCCTGCCTCCCATTG
TACAACTAGGAAATCTGAGGCTCGGAAAGCCTGAGGCAGAGCGGCCGTGCCTGTCAGGGT
GGTGGCTAGGTGTGTCCATTCTGTCCACCGCATGCAGCGGCCTCCTCAGGAGCCTGGGAG
GACAGGGGAGGCTCCCCAGGGAGAGGATGGTTGGTGTAGGAGTTAATGGGATAGCGAGGG
AGTGGGCATTCCAGGCAGCGGCAAGAGCCTGTGCAGCGGTTGGAGGAGCCAAGCAGCCTG
CAGTTCAGGCTGGCAGGAACGAAGGGCATGTGTGGGGGAGCACTGGCATGGATCGGGTGG
GAGAGGTGTGGACTGGAGGGGTAGGCCTTTATCCCTCCCGCTCTGGGGTGCCCCAGAGGC
TCTTGGGGGAGGGGTGTACTCAATTCTGCTCAAGGAAAGTCCTGAGAAGTTGGGAGTTGG
GAGGCTAGATTGGAGGGGCTGGGAGCTGCTCAGTGGCCTGTGGCAGAGATTAAGTGAAAT
CCATGTGCCTGAAATGGAGGAGAAAAAGTCACTGCTCTTCTTTCTGTCCTCCTTCCGACA
CCCATGGTATGTGTGGAGGGGCAAGGGGTGCTAGGTCCTGATTCACAGGGAGACTGCTGG
CAGAAGCCTGACCACTTTCCCTGGAGTGGGTCAGCGGCCGACCTCCTCAGTGGCCTGGCC
AGGAGCTGTTCTGATCCCGCCCATTTCTTCCTGTTGTCTCCTCATCCAGTGTTTTTTTTT
TGTTTTTGTTTTTAACCATTTTTTCATCTCCCAAGGCTCTGTCATGCATCAATGCAGTTT
TGATTTCACATATGGGGAGTGGTTTTGTTACTGCCCCTTGAGGGCTGGAGAACTTTGGCA
CGCAGTAGGCTCTGAGCAAATATTTGTAAGCATGTAGGAGTGAGTATTGGTCTAACTATG
GGACCCTGTGCCCAAGGCCCATCCCTGGCATGCGGTGGCAGGAGAATTGAACAGTAGCCC
CTTGCAAGAGGTGGCCTCTGCCCATCCTCAGGTGGACTCTGTCTTCCCATGGGAAGAAAC
TTTCTTTCCTCATCCCTTGGAAACTAGGTGGGGGGCTCTTGGGCAGCCTGGTCTTGCCAC
AGTCCTGGGATCCTGGCCGGGTTCGAGACTTTCCCTGCTGCCCCCTTCCCCCCGCCCCCT
TGGGTGGCTAACAGAGGCAGCCTTGTTCCTGCTCCCATAGAGCTGCCCTGTTTTCTGCAC
ACTAAAAATGGAAACCCCCAAGCTATTTCGGGAGCAGTGCCCAGCCAGGCTGTGACCACG
GCCCCCCTGCTCCCACCGGGCTGTGGCCACAGTGTCCCGGCTTCCACCAGGCTGCTGGAC
CCTCCCCTGAGCCTTGTGCCCGGCCCTGTTCACTTCAGGGCAGCCTCAGGAGTACCCTGC
TCAGGCCTCATCTGCTAGGATGAGCCGACCTGGGAGAAGCAAACGCTTGGGATATTTTGC
ACAGACAGCTTGGCAGCTGGGTGATGGGAGGGGCTGGGCAACGTGGCCTGGGCACAGGCA
AGTAGGGGAAGTGTCTCCCAGTCTGAGATGCATTGTCTGTCCCAGCACTTCACCAACCTT
GGTGCTCCTGGCTAGAGACCACTGGGGAAGGTGGTATTGCCATAGTTTCTTGGTTCAGGG
ACTCAGGAGCCTCAGCTGGGGCCCAAGAAGGGGTCTGTGTGGAAAGCAGGCACCCAAAGT
CTGGGGAGGTCCTGGGGATGGGCCTGGGAACAGCCAGGCATGGCACCTTCCTCCAGGACA
CACTCCACTTACCCCACATCTTGGGCCCTGGCACTATTCTGAACTGCAGGAGAGGAAATA
GCAAGAGATGGCCTAGCTTCTACAGCTCTCTAGTACGTAGGGCTCCAACTAAGTACTCTC
AAACGAGGGGAGTGTGCCTGAGTGTGCGTGTGTATGTCTAAATGTGAGTGGTGGTCTGAA
TGTCTCGGGTGAGTGTGACATATGTGCCTGCAGTGTGTTTCTGTGTGGGGGAGTTGTCTC
TATATGGATGTGTCTTCATGTGGTGTTTGAACATGGGTGGCTGTGTCTGTGTGTGTCACT
GTGCTGTGTGTATAGATGGCATCTGCATCTCTCTCTCTCTGTGTGTGTGTGTGTGTGTGT
GTGTGTGTGTTGTAGGCATATACATACAGGGTGGGTGGTGTGTATGTATCTTGCTGTGCG
ACTGCCTGTCTGCTGAAGCGCTGGTGGCCCTTTGGGCTGGGACAGCCCCTGGCTGTGTAG
AGGGTGTGTACCTGGGTGCCTTTACAGGGTGGAGTTTGAGCAGAGAGAGGGACCTCACAG
GGAGAAGGCCATGCTGGGGGCCTGGCTGGGCCCTGCCAGCCACGGGGCTCCTTCCTAGCT
GACCTTTCCCAGGCCCCTCGGGTGCCTGGCTCTGCTGCCCTCCCCCTCCTCATGTGGGCT
CTGAGGAGGCGTCCTCTGTGGAATGTGTTTGGTGGCCAGGGGCCAGGCTGGGCCCAGCTC
CACCAGCAGGCTGGGCGGTGGGGAGGGGGTGCTTCTGTGCTGCCTCCCCGGTGGGGAGCC
CAGGGCTTCCACGTGCCTGCAGCCCAGGCCCCGGCTTCACACTCGGCTTTCCCGCCTGCT
AGGTGACTCCCACACGGGTCATGCTGTTGTCTCCTGATCCAGCCGGCCCTGCCAGGTGAC
CATGCCTGCTCTGGGCCCAGCTCTTCTCCAGGCTCTCTGGGCCGGGTGGGTCCTCACCCT
CCAGCCCCTTCCACCAACTGCATTCACTCCCAATGGCACGTATCTGCAGCACCTGGCAAG
GGACCCCACCTCAGGCACCCTCTACCTGGGGGCTACCAACTTCCTGTTCCAGCTGAGCCC
TGGGCTGCAGCTGGAGGCCACAGTGTCCACCGGCCCTGTGCTAGACAGCAGGGACTGCCT
GCCACCTGTGATGCCTGATGAGTGCCCCCAGGCCCAGCCTACCAACAACCCGAATCAGCT
GCTCCTGGTGAGCCCAGGGGCCCTGGTGGTATGCGGGAGCGTGCACCAGGGGGTCTGTGA
ACAGCGGCGCCTGGGGCAGCTCGAGCAGCTGCTGCTGCGGCCAGAGCGGCCTGGGGACAC
ACAATATGTGGCTGCCAATGATCCTGCGGTCAGCACGGTGGGGCTGGTAGCCCAGGGCTT
GGCAGGGGAGCCCCTCCTGTTTGTGGGGCGAGGATACACCAGCAGGGGTGTGGGGGGTGG
CATTCCACCCATCACAACCCGGGCCCTGTGGCCGCCCGACCCCCAAGCTGCCTTCTCCTA
TGAGGAGACAGCCAAGCTGGCAGTGGGCCGCCTCTCCGAGTACAGCCACCACTTCGTGAG
TGCCTTTGCACGTGGGGCCAGCGCCTACTTCCTGTTCCTGCGGCGGGACCTGCAGGCTCA
GTCTAGAGCTTTTCGTGCCTATGTATCTCGAGTGTGTCTCCGGGACCAGCACTACTACTC
CTATGTGGAGTTGCCTCTGGCCTGCGAAGGTGGCCGCTACGGGCTGATCCAGGCTGCAGC
TGTGGCCACGTCCAGGGAGGTGGCGCATGGGGAGGTGCTCTTTGCAGCTTTCTCCTCGGC
TGCACCCCCCACTGTGGGCCGGCCCCCATCGGCGGCTGCTGGGGCATCTGGAGCCTCTGC
CCTCTGTGCCTTCCCCCTGGATGAGGTGGACCGGCTTGCTAATCGCACGCGAGATGCCTG
CTACACCCGGGAGGGTCGTGCTGAGGATGGGACCGAGGTGGCCTACATCGAGTATGATGT
CAATTCTGACTGTGCACAGCTGCCAGTGGACACCCTGGATGCTTATCCCTGTGGCTCAGA
CCACACGCCCAGCCCCATGGCCAGCCGGGTCCCGCTGGAAGCCACACCAATTCTGGAGTG
GCCAGGGATTCAGCTAACAGCTGTGGCAGTCACCATGGAAGATGGACACACCATCGCTTT
CCTGGGTGATAGTCAAGGGCAGCTGCACAGGGTCTACTTGGGCCCAGGGAGCGATGGCCA
CCCATACTCCACACAGAGCATCCAGCAGGGGTCTGCAGTGAGCAGAGACCTCACCTTTGA
TGGGACCTTTGAGCACCTGTATGTCATGACCCAGAGCACACTTCTGAAGGTTCCTGTGGC
TTCCTGTGCTCAGCACCTGGACTGTGCATCTTGCCTTGCTCACAGGGACCCATACTGTGG
GTGGTGCGTGCTCCTTGGCAGGTGCAGTCGCCGTTCTGAGTGCTCGAGGGGCCAGGGCCC
AGAGCAGTGGCTATGGAGCTTCCAGCCTGAGCTGGGCTGTCTGCAAGTGGCAGCCATGAG
TCCTGCCAACATCAGCCGAGAGGAGACGAGGGAGGTTTTCCTATCAGTGCCAGACCTGCC
ACCCCTGTGGCCAGGGGAGTCATATTCCTGCCACTTTGGGGAACATCAGAGTCCTGCCCT
GCTGACTGGTTCTGGTGTGATGTGCCCCTCCCCAGACCCTAGTGAGGCCCCAGTGCTGCC
GAGAGGAGCCGACTACGTATCCGTGAGCGTGGAGCTCAGATTTGGCGCTGTTGTGATCGC
CAAAACTTCCCTCTCTTTCTATGACTGTGTGGCGGTCACTGAACTCCGCCCATCTGCGCA
GTGCCAGGCCTGTGTGAGCAGCCGCTGGGGGTGTAACTGGTGTGTCTGGCAGCACCTGTG
CACCCACAAGGCCTCGTGTGATGCTGGGCCCATGGTTGCAAGCCATCAGAGCCCGCTTGT
CTCCCCAGACCCTCCTGCAAGAGGTGGACCCAGCCCCTCCCCACCCACAGCCCCCAAAGC
CCTGGCCACCCCTGCTCCTGACACCCTTCCCGTGGAGCCTGGGGCTCCCTCCACAGCCAC
AGCTTCGGACATCTCACCTGGGGCTAGTCCTTCCCTGCTCAGCCCCTGGGGGCCATGGGC
AGGTTCTGGCTCCATATCTTCCCCTGGCTCCACAGGGTCGCCTCTCCATGAGGAGCCCTC
CCCTCCCAGCCCCCAAAATGGACCTGGAACCGCTGTCCCTGCCCCCACTGACTTCAGACC
CTCAGCCACACCTGAGGACCTCTTGGCCTCCCCGCTGTCACCCTCAGAGGTAGCAGCAGT
GCCCCCTGCAGACCCTGGCCCCGAGGCTCTTCATCCCACAGTGCCCCTGGACCTGCCCCC
TGCCACTGTTCCTGCCACCACTTTCCCAGGGGCCATGGGCTCCGTGAAGCCCGCCCTGGA
CTGGCTCACGAGAGAAGGCGGCGAGCTGCCCGAGGCGGACGAGTGGACGGGGGGTGACGC
ACCCGCCTTCTCCACTTCCACCCTCCTCTCAGGTGATGGAGACTCAGCAGAGCTTGAGGG
CCCTCCCGCCCCCCTCATCCTCCCGTCCAGCCTCGACTACCAGTATGACACCCCCGGGCT
CTGGGAGCTGGAAGAGGCGACCTTGGGGGCAAGCTCCTGCCCCTGTGTGGAGAGCGTTCA
GGGCTCCACGTTGATGCCGGTCCATGTGGAGCGGGAAATCCGGCTGCTAGGCAGGAACCT
GCACCTTTTCCAGGATGGCCCAGGAGACAATGAGTGTGTGATGGAGCTGGAGGGCCTCGA
GGTGGTGGTTGAGGCCCGGGTCGAGTGTGAGCCACCTCCAGATACCCAGTGCCATGTCAC
CTGCCAGCAGCACCAGCTCAGCTATGAGGCTCTGCAGCCGGAGCTCCGTGTGGGGCTGTT
TCTGCGTCGGGCCGGCCGTCTGCGTGTGGACAGTGCTGAGGGGCTGCATGTGGTACTGTA
TGACTGTTCCGTGGGACATGGAGACTGCAGCCGCTGCCAAACTGCCATGCCCCAGTATGG
CTGTGTGTGGTGTGAGGGGGAGCGTCCACGTTGTGTGACCCGGGAGGCCTGTGGTGAGGC
TGAGGCTGTGGCCACCCAGTGCCCAGCGCCCCTCATCCACTCGGTGGAGCCACTGACTGG
GCCTGTAGACGGAGGCACCCGTGTCACCATCAGGGGCTCCAACCTGGGCCAGCATGTGCA
GGATGTGCTGGGCATGGTCACGGTGGCTGGAGTGCCCTGTGCTGTGGATGCCCAGGAGTA
CGAGGTCTCCAGCAGCCTCGTGTGCATCACCGGGGCCAGTGGGGAGGAGGTGGCCGGCGC
CACAGCGGTGGAGGTGCCGGGAAGAGGACGTGGTGTCTCAGAACACGACTTTGCCTACCA
GGATCCGAAGGTCCATTCCATCTTCCCGGCCCGCGGCCCCAGAGCTGGGGGCACCCGTCT
CACCCTGAATGGCTCCAAGCTCCTGACTGGGCGGCTGGAGGACATCCGAGTGGTGGTTGG
AGACCAGCCTTGTCACTTGCTGCCGGAGCAGCAGTCAGAACAACTGCGGTGTGAGACCAG
CCCACGCCCCACGCCTGCCACGCTCCCTGTGGCTGTGTGGTTTGGGGCCACGGAGCGGAG
GCTTCAACGCGGACAGTTCAAGTATACCTTGGACCCCAACATCACCTCTGCTGGCCCCAC
CAAGAGCTTCCTCAGTGGAGGACGTGAGATATGCGTCCGTGGCCAGAATCTGGACGTGGT
ACAGACGCCAAGAATCCGGGTGACCGTGGTCTCGAGAATGCTGCAGCCCAGCCAGGGGCT
TGGACGGAGGCGTCGCGTGGTCCCGGAGACGGCATGTTCCCTTGGACCCTCCTGCAGTAG
CCAGCAATTTGAGGAGCCGTGCCATGTCAACTCCTCCCAGCTCATCACGTGCCGCACACC
TGCCCTCCCAGGCCTGCCTGAGGACCCCTGGGTCCGGGTGGAATTTATCCTTGACAACCT
GGTCTTTGACTTTGCAACACTGAACCCCACACCTTTCTCCTATGAGGCCGACCCCACCCT
GCAGCCACTCAACCCTGAGGACCCCACCATGCCATTCCGGCACAAGCCTGGGAGTGTGTT
CTCCGTGGAGGGGGAGAACCTGGACCTTGCAATGTCCAAGGAGGAGGTGGTGGCTATGAT
AGGGGATGGCCCCTGTGTGGTGAAGACGCTGACGCGGCACCACCTGTACTGCGAGCCCCC
CGTGGAGCAGCCCCTGCCACGGCACCATGCCCTCCGAGAGGCACCTGACTCTTTGCCTGA
GTTCACGGTGCAGATGGGGAACTTGCGCTTCTCCCTGGGTCACGTGCAGTATGACGGCGA
GAGCCCTGGGGCTTTTCCTGTGGCAGCCCAGGTGGGCTTGGGGGTGGGCACCTCTCTTCT
GGCTCTGGGTGTCATCATCATTGTCCTCATGTACAGGAGGAAGAGCAAGCAGGCCCTGAG
GGACTATAAGAAGGTTCAGATCCAGCTGGAGAATCTGGAGAGCAGTGTGCGGGACCGCTG
CAAGAAGGAATTCACAGACCTCATGACTGAGATGACCGATCTCACCAGTGACCTCCTGGG
CAGCGGCATCCCCTTCCTCGACTACAAGGTGTATGCGGAGAGGATCTTCTTCCCTGGGCA
CCGCGAGTCGCCCTTGCACCGGGACCTGGGTGTGCCTGAGAGCAGACGGCCCACTGTGGA
GCAAGGGCTGGGGCAGCTCTCTAACCTGCTCAACAGCAAGCTCTTCCTCACCAAGTTCAT
CCACACGCTGGAGAGCCAGCGCACCTTTTCAGCTCGGGACCGTGCCTACGTGGCATCTCT
GCTCACCGTGGCACTGCATGGGAAGCTTGAGTATTTCACTGACATCCTCCGCACTCTGCT
CAGTGACCTGGTTGCCCAGTATGTGGCCAAGAACCCCAAGCTGATGCTGCGCAGGACAGA
GACTGTGGTGGAGAAGCTGCTCACCAACTGGATGTCCATCTGTCTGTATACCTTCGTGAG
GGACTCCGTAGGGGAGCCTCTGTACATGCTCTTTCGAGGGATTAAGCACCAAGTGGATAA
GGGGCCAGTGGACAGTGTGACAGGCAAGGCCAAATACACCTTGAACGACAACCGCCTGCT
CAGAGAGGATGTGGAGTACCGTCCCCTGACCTTGAATGCACTATTGGCTGTGGGGCCTGG
GGCAGGAGAGGCCCAGGGCGTGCCCGTGAAGGTCCTAGACTGTGACACCATCTCCCAGGC
AAAGGAGAAGATGCTGGACCAGCTTTATAAAGGAGTGCCTCTCACCCAGCGGCCAGACCC
TCGCACCCTTGATGTTGAGTGGCGGTCTGGGGTGGCCGGGCACCTCATTCTTTCTGACGA
GGATGTCACTTCTGAGGTCCAGGGTCTGTGGAGGCGCCTGAACACACTGCAGCATTACAA
GCAGGTCCCAGATGGAGCAACTGTGGCCCTCGTCCCCTGCCTCACCAAGCATGTGCTCCG
GGAAAACCAGGATTATGTCCCTGGAGAGCGGACCCCAATGCTGGAGGATGTAGATGAGGG
GGGCATCCGGCCCTGGCACCTGGTGAAGCCAAGTGATGAGCCGGAGCCGCCCAGGCCTCG
GAGGGGCAGCCTTCGGGGCGGGGAGCGTGAGCGCGCCAAGGCCATCCCTGAGATCTACCT
GACCCGCCTGCTGTCCATGAAGGGCACCCTGCAGAAGTTCGTGGATGACCTGTTCCAGGT
GATTCTCAGCACCAGCCGCCCCGTGCCGCTCGCTGTGAAGTACTTCTTTGACCTGCTGGA
TGAGCAGGCCCAGCAGCATGGCATCTCCGACCAGGACACCATCCACATCTGGAAGACCAA
CAGCTTGCCTCTGAGGTTCTGGATCAATATAATAAAAAACCCGCAGTTTGTGTTCGACGT
GCAAACATCTGATAACATGGATGCGGTGCTCCTTGTCATTGCACAGACCTTCATGGACGC
CTGCACCCTGGCCGACCACAAGCTGGGCCGGGACTCCCCGATCAACAAACTTCTGTATGC
ACGGGACATTCCCCGGTACAAGCGGATGGTGGAAAGGTACTATGCAGACATCAGACAGAC
TGTCCCAGCCAGCGACCAAGAGATGAACTCTGTCCTGGCTGAACTGTCCTGGGGAAGCCC
TTGGGAACCTCAGCAGCCCTGTGAGCTGGTTGGGGCAGGAAACATAAATGCAGAATGTTC
CAACTGCCACTGAAAGACCAGGGCTCCCACCATCTCATCACAGAGCAAGCAGGGGTCTTG
TCCTGGCAGCTGCCATGTACCCTGATTCAGCCAGGCTCTTGCAAGAACTACTCCGGAGAC
CTCGGGGCGCGAGTGGCCCTGCATGAACTCTACAAGTACATCAACAAGTACTATGACCAG
ATCATCACTGCCCTGGAGGAGGATGGCACGGCCCAGAAGATGCAGCTGGGCTATCGGCTC
CAGCAGATTGCAGCTGCTGTGGAAAACAAGGTCACAGATCTATAGGAACCCAGGAGCCAC
GGCCTGCTGTTGCTTCAGCCTGGCCTGGGCAGCCCTGGAAGCTCGGAGGAGAGGCCACCT
TCTTAGGTGCCTGTAGTGACTGACAAGCAGAGTTAGTGGAAGGTGACTCCCAGTCTCCTG
GTGGCTCTGGCCTCGGCCCTGCTGGATCCACCTCCTAGACCCGGGGCCTCAAGGCTCATG
GGGTAGTACCCAGCCTGCTCCCCGAGTCCAGCGACCCTGTGACACCGGTCTGCAGGGAGT
TGGGGACTAAGGGCTTCCAGAGAGTGGCTGGAAGAGACTCCAGGCCCCTGGGGAGACTGT
ACTGTTCCTGAACACTGGCCTTGGCCACACTGGGATTCGGAGAGGAAGGAGGAGAGCCCC
ATGCTTCCTGTCTGCCTCCTCCACCATCCCTGACCTCAGTTGAGCTGCCTCTGGCCTTGT
TGCTGCTGCCACATCCTAGGTCTAAGAGTTGAACGCCTCTCCTAGGCCACTACAAACTGA
CCCCTCAGCAGGGCTGGCTGCCACAGGGCTGCCCTGCCTCATAGGTAGCCATGGTGAGGG
CTATCTGCTGCAGGGGGGTCTTGGGGAGAGTGGTGACTCCATTGACCCAGCTTTTCATTA
AAGGATAACACACTGCA

Protein Sequence

>5364 : length: 2136
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSP
GLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCE
QRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQ
SRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSA
APPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDV
NSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAF
LGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVA
SCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESYSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLP
RGADYVSVSVELRFGAVVIAKTSLSFYDCVAVTELRPSAQCQACVSSRWGCNWCVWQHLC
THKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPSTAT
ASDISPGASPSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPGTAVPAPTDFRP
SATPEDLLASPLSPSEVAAVPPADPGPEALHPTVPLDLPPATVPATTFPGAMGSVKPALD
WLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQYDTPGL
WELEEATLGASSCPCVESVQGSTLMPVHVEREIRLLGRNLHLFQDGPGDNECVMELEGLE
VVVEARVECEPPPDTQCHVTCQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLY
DCSVGHGDCSRCQTAMPQYGCVWCEGERPRCVTREACGEAEAVATQCPAPLIHSVEPLTG
PVDGGTRVTIRGSNLGQHVQDVLGMVTVAGVPCAVDAQEYEVSSSLVCITGASGEEVAGA
TAVEVPGRGRGVSEHDFAYQDPKVHSIFPARGPRAGGTRLTLNGSKLLTGRLEDIRVVVG
DQPCHLLPEQQSEQLRCETSPRPTPATLPVAVWFGATERRLQRGQFKYTLDPNITSAGPT
KSFLSGGREICVRGQNLDVVQTPRIRVTVVSRMLQPSQGLGRRRRVVPETACSLGPSCSS
QQFEEPCHVNSSQLITCRTPALPGLPEDPWVRVEFILDNLVFDFATLNPTPFSYEADPTL
QPLNPEDPTMPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPP
VEQPLPRHHALREAPDSLPEFTVQMGNLRFSLGHVQYDGESPGAFPVAAQVGLGVGTSLL
ALGVIIIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLG
SGIPFLDYKVYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFI
HTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTE
TVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLL
REDVEYRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDP
RTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKQVPDGATVALVPCLTKHVLR
ENQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEPEPPRPRRGSLRGGERERAKAIPEIYL
TRLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAQQHGISDQDTIHIWKTN
SLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYA
RDIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGARVALHELYKYINKYY
DQIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL