ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5347

Name

PLK1

Synonym

PLK|STPK13;polo-like kinase 1;PLK1;polo-like kinase 1

Definition

PLK-1|cell cycle regulated protein kinase|polo (Drosophia)-like kinase|polo like kinase|serine/threonine-protein kinase 13|serine/threonine-protein kinase PLK1

Position

16p12.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Centrosome maturation;PID Reactome;500380

Pathway

Golgi Cisternae Pericentriolar Stack Reorganization;PID Reactome;500931

Pathway

Mitotic Prometaphase;PID Reactome;500976

Pathway

Recruitment of mitotic centrosome proteins and complexes;PID Reactome;500381

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

Polo-like kinase signaling events in the cell cycle;PID Curated;200176

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

Loss of Nlp from mitotic centrosomes;PID Reactome;500384

Pathway

Mitotic Telophase /Cytokinesis;PID Reactome;501001

Pathway

Phosphorylation of Emi1;PID Reactome;500392

Pathway

Loss of proteins required for interphase microtubule organization from the centrosome;PID Reactome;500383

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Pathway

FoxO family signaling;PID Curated;200091

Pathway

DNA Replication;Reactome;REACT:383

Pathway

Mitotic Metaphase/Anaphase Transition;PID Reactome;500868

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

FOXM1 transcription factor network;PID Curated;200120

Pathway

Phosphorylation of the APC/C;PID Reactome;500395

Pathway

M Phase;PID Reactome;500909

Pathway

PLK1 signaling events;PID Curated;200087

Pathway

Polo-like kinase mediated events;PID Reactome;500379

Disease

Cancer;FunDO

Disease

Rheumatoid arthritis;FunDO

External Links

Links to cell senescence gene database

5347

Links to epithelial mesenchymal transition gene database

5347

Links to ovarian cancer gene database

5347

Links to endometrial cancer gene database

5347

Links to iHOP

5347

Sequence Information

Nucleotide Sequence

>5347 : length: 2243
AGTGGCGCGCAGGCTTTTGTAACGTTCCCAGCGCCGCGTTTGAATTCGGGGAGGAGCGGA
GCGGTGCGGAGGCTCTGCTCGGATCGAGGTCTGCAGCGCAGCTTCGGGAGCATGAGTGCT
GCAGTGACTGCAGGGAAGCTGGCACGGGCACCGGCCGACCCTGGGAAAGCCGGGGTCCCC
GGAGTTGCAGCTCCCGGAGCTCCGGCGGCGGCTCCACCGGCGAAAGAGATCCCGGAGGTC
CTAGTGGACCCACGCAGCCGGCGGCGCTATGTGCGGGGCCGCTTTTTGGGCAAGGGCGGC
TTTGCCAAGTGCTTCGAGATCTCGGACGCGGACACCAAGGAGGTGTTCGCGGGCAAGATT
GTGCCTAAGTCTCTGCTGCTCAAGCCGCACCAGAGGGAGAAGATGTCCATGGAAATATCC
ATTCACCGCAGCCTCGCCCACCAGCACGTCGTAGGATTCCACGGCTTTTTCGAGGACAAC
GACTTCGTGTTCGTGGTGTTGGAGCTCTGCCGCCGGAGGTCTCTCCTGGAGCTGCACAAG
AGGAGGAAAGCCCTGACTGAGCCTGAGGCCCGATACTACCTACGGCAAATTGTGCTTGGC
TGCCAGTACCTGCACCGAAACCGAGTTATTCATCGAGACCTCAAGCTGGGCAACCTTTTC
CTGAATGAAGATCTGGAGGTGAAAATAGGGGATTTTGGACTGGCAACCAAAGTCGAATAT
GACGGGGAGAGGAAGAAGACCCTGTGTGGGACTCCTAATTACATAGCTCCCGAGGTGCTG
AGCAAGAAAGGGCACAGTTTCGAGGTGGATGTGTGGTCCATTGGGTGTATCATGTATACC
TTGTTAGTGGGCAAACCACCTTTTGAGACTTCTTGCCTAAAAGAGACCTACCTCCGGATC
AAGAAGAATGAATACAGTATTCCCAAGCACATCAACCCCGTGGCCGCCTCCCTCATCCAG
AAGATGCTTCAGACAGATCCCACTGCCCGCCCAACCATTAACGAGCTGCTTAATGACGAG
TTCTTTACTTCTGGCTATATCCCTGCCCGTCTCCCCATCACCTGCCTGACCATTCCACCA
AGGTTTTCGATTGCTCCCAGCAGCCTGGACCCCAGCAACCGGAAGCCCCTCACAGTCCTC
AATAAAGGCTTGGAGAACCCCCTGCCTGAGCGTCCCCGGGAAAAAGAAGAACCAGTGGTT
CGAGAGACAGGTGAGGTGGTCGACTGCCACCTCAGTGACATGCTGCAGCAGCTGCACAGT
GTCAATGCCTCCAAGCCCTCGGAGCGTGGGCTGGTCAGGCAAGAGGAGGCTGAGGATCCT
GCCTGCATCCCCATCTTCTGGGTCAGCAAGTGGGTGGACTATTCGGACAAGTACGGCCTT
GGGTATCAGCTCTGTGATAACAGCGTGGGGGTGCTCTTCAATGACTCAACACGCCTCATC
CTCTACAATGATGGTGACAGCCTGCAGTACATAGAGCGTGACGGCACTGAGTCCTACCTC
ACCGTGAGTTCCCATCCCAACTCCTTGATGAAGAAGATCACCCTCCTTAAATATTTCCGC
AATTACATGAGCGAGCACTTGCTGAAGGCAGGTGCCAACATCACGCCGCGCGAAGGTGAT
GAGCTCGCCCGGCTGCCCTACCTACGGACCTGGTTCCGCACCCGCAGCGCCATCATCCTG
CACCTCAGCAACGGCAGCGTGCAGATCAACTTCTTCCAGGATCACACCAAGCTCATCTTG
TGCCCACTGATGGCAGCCGTGACCTACATCGACGAGAAGCGGGACTTCCGCACATACCGC
CTGAGTCTCCTGGAGGAGTACGGCTGCTGCAAGGAGCTGGCCAGCCGGCTCCGCTACGCC
CGCACTATGGTGGACAAGCTGCTGAGCTCACGCTCGGCCAGCAACCGTCTCAAGGCCTCC
TAATAGCTGCCCTCCCCTCCGGACTGGTGCCCTCCTCACTCCCACCTGCATCTGGGGCCC
ATACTGGTTGGCTCCCGCGGTGCCATGTCTGCAGTGTGCCCCCCAGCCCCGGTGGCTGGG
CAGAGCTGCATCATCCTTGCAGGTGGGGGTTGCTGTATAAGTTATTTTTGTACATGTTCG
GGTGTGGGTTCTACAGCCTTGTCCCCCTCCCCCTCAACCCCACCATATGAATTGTACAGA
ATATTTCTATTGAATTCGGAACTGTCCTTTCCTTGGCTTTATGCACATTAAACAGATGTG
AATATTCAAAAAAAAAAAAAAAA

Protein Sequence

>5347 : length: 603
MSAAVTAGKLARAPADPGKAGVPGVAAPGAPAAAPPAKEIPEVLVDPRSRRRYVRGRFLG
KGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFF
EDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLG
NLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCI
MYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELL
NDEFFTSGYIPARLPITCLTIPPRFSIAPSSLDPSNRKPLTVLNKGLENPLPERPREKEE
PVVRETGEVVDCHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDK
YGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLK
YFRNYMSEHLLKAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTK
LILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSASNRL
KAS