ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

53344

Name

CHIC1

Synonym

BRX;cysteine-rich hydrophobic domain 1;CHIC1;cysteine-rich hydrophobic domain 1

Definition

brain X-linked protein|cystein-rich hydrophobic domain 1|cysteine-rich hydrophobic domain 1 protein|cysteine-rich hydrophobic domain-containing protein 1

Position

Xq13.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

53344

Links to epithelial mesenchymal transition gene database

53344

Links to ovarian cancer gene database

53344

Links to endometrial cancer gene database

53344

Links to iHOP

53344

Sequence Information

Nucleotide Sequence

>53344 : length: 6909
AACACGCAGGCGCGTCTCCTCAAATCCTGTCCCTACACCCCTCCTCTTTCTCTTCATTTC
GTTCCCCCTCCTCTTGCAGCACCTCGGCAGGTTCAAACTCTTCTCCGGGAGCGTGGCGGC
GATCGCGAGGTCACGTGATGAGCATCCTGCTGCCCAACATGGCGGAGTTCGACACCATCT
CGGAACTGGAGGAGGAGGAGGAAGAAGAAGCGGCAACGTCGTCGTCGTCGCCGTCGTCGT
CGTCGTCGGTATCTGGGCCCGACGATGACGAGGAGGATGAGGAGGAAGAGGAGGAAGAGG
AGGAGGAGGAAGAAGAGGAGGAGGAGGAAGAGGAGGAGGAAGCGCCGCCCCCGCCTCGGG
TAGTGAGCGAGGAGCATCTGCGGAGATATGCTCCCGACCCTGTATTAGTGCGGGGTGCCG
GCCACATCACTGTGTTTGGCTTGAGCAACAAGTTTGATACTGAATTTCCCTCCGTTCTAA
CAGGGAAGGTGGCCCCAGAAGAATTTAAAACCAGCATTGGCCGTGTGAATGCATGTTTGA
AAAAGGCTCTCCCGGTCAATGTGAAATGGCTGCTGTGTGGTTGTCTCTGCTGCTGTTGCA
CACTGGGTTGCAGCCTATGGCCTGTTATTTGTCTCAACAAAAGAACCAGAAGATCAATTC
AGAAGTTAATAGAATGGGAAAATAACAGATTATATCACAAGCTTGCTTTGCACTGGAAGT
TGACTAAGAGGAAATGTGAAACTAGCAATATGATGGAGTATGTAATACTAATAGAATTCT
TACCAAAATATCCCATATTCCGACCTGACTGAGGAGTTTTATCCAGTCACTTCTGTGTTA
CCTGTCATTTCCTACCCTTAGTGCCTTGTAGATTTGGAATGAAGATGGTCTCCTTTGCTG
TGTTCAACTTATTCTTTATAATGGTAGAATATTCTTCTCGCTCTTTTGTGTTGGTTTATG
AAGAAAATTTGCACATCTTTTTTGTCTTTCAATGAGGCTTGTGTTTTGCACTCTCAATTT
TAAATACACACACATGCGTGTGTGCATATACATATATAGATAGTTGCCATTAAAGATAAA
TCATCAGTGTTGGTGTTTAAAAAACAAAAACTTGTTCTGAGCATGCTGCCTTATAATTTT
CATACTCATTGTTTCTAAACTCGCATCATTTTTCTAGGCTACTTGATGCTCTGTAATCCC
TTACTGGACAAACTTAAATAAGCTTTTGGTAGCTTTTAGAAATGGTTTTACTCTGCTTTT
AAAGGACATGCTTTTAAAGGACATGCAATTAATGGCACTGGTTTTGTCCTGCACTTTGCT
TTATCACTTATGTTAGTGGATAAAATATTTAAACTCCTAAAGACTTGTAAATATTGCCTC
TTTGCATAATGTAAAATGTGGTATGCCATGGTTTACATAATGTAACATTACTCTTATTGT
ATTGCCAACAATTTTACATAGATTTTAATATGAATGAAGTTTGCAAGCATCCCTTTGAAT
GTAGAAACTGCTAACATGCTGTTTTATGGCAAGGCCATAATGAGTATGTTAAGAATTTCA
GGTGTAGGGCAAGGTTGCCCTTTGTAACAAGTGGACTAAAATTGAAATTATTATCTCAGA
TATTCTGTATTGCACCTGAAACCATGACCTTTATTTTTCCATTTCGTTTAATAATTTCCA
TTTTGTTGTCTACTCCTTCCCACAAAAAAACTATTTGACATCTGACACATTTCACAGTCT
CACTATCCTGCATTTATTAGCCTTTTCTTCCTTTGAAAATACACACAATTATGACTTTTA
AGGAGTATTTTGAGATTTCAGACATCTTCAGAAGGTATCTAGACCCTCTTGAAAGCCACT
AACACCTTTCTGCAGTTCTGATATTCTAGTTTGAGAAAGAGAGAGAACTATTTGAGAAGC
TGTAGCTAAAGAGTATATAGCAGCTGATTCATAATTGAAAAAAAATTCTCAATTCTGTTT
TTGATGATCCTTTATAAAACATTAATGAGGAAAGACAAGTGTTTAGACAAAAGTATTTTA
GTTTATAAATTCAGCACATATGTAACATTTATTTGGTCCATATTTCTCTATTTTTCTTCA
CAATTAAAATGATTGCTAGCACCACACAACTAGAATTTGAAAATTCAGTATAATGAAAGC
TTTATATCACATTAATTCAACTGCAAATGTATGCCTGTTTGTAGGCATTATTTGTAATTC
ATAGTGCTAAAAATAAAAGTGTCTAGGGCTCAGTAATATTTTGTCATCTTACTCTTACTG
CTTTTAGTAAACCTTTTAGGCAAGATTCATCTCAGTGAAGTGAACAATCATTTCTTCATA
GAAGGTCAAGCCTTTTTAAGCCACTCTTAAAATTTATGCCTAATTTGAAATCCACAGTCC
TTGACCAGTTTAAAAAAGAGAGGAAAAAGAAGACACTATTTTATATGTGATTATAATTGT
TTGCACAAACACTTTTCCACCTTCCTCTGTGCCCCATTACCTCTGTGCCACTCAGTCACC
CCAAATCTCTAACCTTTAGTAATGTGTATGCCTGCAAATATTATGTGTTTGCCTGCTGCA
AAATTGAAGGTGTATTTTTATAGACAAGGTAGAAGCCTCTGAAAATGTATACCAAATGTC
TTGTTTTGTAGCTAAGGTCGGGAAAAATTGTATCTGAGGTTTATGTTCCAGCTAATGTTA
TCAAATTTATGCTTCAAACTGTGATATTTTAATACCAAAATCGATTTTCAGCATAATACA
AAATATCTCATTTTCACTGATAGAAAATTGCTTTTAAGTGTTGATCCTTAGAAATCTTAT
TTTTTTCTATAACCTTAGAATTTGATCATATGATGGTCATAGGAACTTTTTCTGCCATGT
ATAAATCACACTTGGTTTTGCTCAAAGAACAGCATGAAGTGGTGAATTGTTTCCATGAAA
CAATTATTGAGAATGGGAATACAGTATATCTGGAAATGACACAGTATAATACAAGTTACA
GTAGCATTTGTCACAAAAACCACTTGTCAGCATGTGTAAACTTAATTTTAAAGCCTATTC
TAATCACTCGAGTTTATTATTTTATTGTTCGCTATGCTGGTTGACTCATCTTAGTTTCTT
CAACTACCCAAAAAAATACCAATTTTTTTCCTCTCTTGTATGACTACTTTTTCAAACTGT
TTTCCTTTGCAGGGGGCTGATTAGCAATTGAGTATTTTGTAATGTTTGGGCGGGGTTGCT
TTGTTTTCAGTGAAATTGGTTGCAGTGAATGCTAAAATGACACAGCACACTGGTGATTAA
TTCCTCCCCCATGGAGCCTTTTTTCTGTTATGCTTAGGATAGAACATACTTGTAATTTTC
CATTAGGTTAGTAACATACTTTTGTGAAAGTTGTTTTTAGACTGAAGAAAGTAATTTTGA
ATTTCTTTGTTACATAATATTCCTTTATGAAACTTGTGATAGTTTCCAGAGCAAAACATG
TATTTGCCAAAGTATATAAATCTCACAAGGCTTTAAGATTACAAGCTAAAATTGTTTTTT
AAAATTAATGTTCCAATGTTTCTCATTTGGCCCAAGATTCTGGCTTCATAAATTTGTCCA
ACTGGCTATTTTTAAGCTTGTCCTAAAAGCCAATAACATGTTTATTCCTAATAACTAATA
TGGGCAAGTGTTATTTACAGATTTATTAACTCCATCCCAGATATGTCTCCACTCTTTGTT
CCCTCCTAATGCTAATTTAGGAAAGAGACCACTGTAGTAAAACTTTAGAAGAAGATGGAG
AAGTGCCTTGTCTTTTTAGAACAAAGATAACACATTACGTGTAAGGAAGCATAATAAATG
AATTGGTAGATGATTAGATTAGAAATCATCCTTTTCAACTAGGTCTAAGAATACTTTACT
AGTGTATTATCTTTTATTTATTATGTAAAGCTTCTTTCCTTCCTTTTCCCCAATCATGAT
ATATTAGTGACAAAATATTACAGAACCGGACTATCAGTCACTTAAAAAAACAGTATAATT
CTAATGCTAGTAAACATGTAATTTAATTTAGTTCTGGAAGGACAGTTGTCTTTGATTAAA
GCCCCACCAAAACCCATTTAAGTATTTAATGTACATACTATTCATATTATTATGGCCTGT
AAACACTAATATCTGAGCAATCAAACTGTTTTATCTACCATTTTTGATGAAATTTGAATA
AAGTTTAAAAACGTGTAAGCCTTTGAACAAATGTATGAAAGCTTTAAAAGATCATTAGCA
CTTTTATTTTGTTTACAAATAAGCTGCCATTTAAAAAAATAAAACCTCACTACTTGAACA
TAAAGCTCCCAAACAATATTGTATTAAAATGTACTATATTGACCTAGGAGGATATAGAAA
TTATATTCACCTGATTAACTGGAGCAGTTTCACATAGTAGAAATACTTTTTGCTAATTTG
ATTATAAGTGCTCAAATTTATTGAAATTAGATTCTCATGCCTATAAAAGTATACTTTAAA
AATATTTTGCAACAACTGTCAAATTATTTGGGTTCCTTTAAATAGCAAACAATTGGGAAA
TTTTCCATAAAAATGAATAGGTTTTATTAATACCTGTTCATGTAGTATGTGGACTAAAAC
AATTGATATATATCTGTATGTAAAAATGAATGATCTTATCTTGCCCCAAATTTTTCTTAC
CTGATTCTGAGCCAGCCTTTTTGTTTTGATGGCACCCTGTGAGTATGTTCCATTTTCTGT
GAACTTTGTCAAATTCATACTATATGAGGAAATGATCTAATATTGTGGGCTCCAGGCAGG
TCATCTTAATTGCATGTCTGTCTCTTCTGTAAAATGATGAGGTGGAACCTAGAGCTGGAC
AAAAAATTAGAGATCACTTAACATTCTGTGATTCAAGGAATTCTTAGGACATTTTTACTC
TATAGAATCTCAGAATGATTATTCTCAGATCTACTGTCCTTGGTGGAAACTCTCACAGTG
CCTTGCATGCAGTAAAAGTTTGATTTGCCGACTGGCTGACGTGTTAATTATCACACAGAC
TCCAAGAACCTGATGCTTGCTAGACCTTAGTTCCTTGGTGATGCTAAGAGTAAATGTAGT
TTTCCTAGGAACTGAGCACTGAGGTCTGTGTCCTTTGCCTGTGTAGAATCTGTCTATGCA
GTTGGTATTCAGGCAAGAATTTTAGCTGTAACAACAATGGAAATATTGGAGGACCCACTT
TGGCATTTATGTAAAGATTTCATATCCTATCCAACATTTACTTTAGTGTCTAATCAAATT
CCATACCCTCAAAAAGATCTGTTGGAACAAATTGATAAAATTAGGTGGAAAGGAAAGTGG
TATGGGACTCAAATACAAGTCACTTCTGGTTTAATTATTGGCTCTGCTGCTTAATTCCTC
TGTACCTCACGTCCTCATTGTCGAAGTGGGGACAATAATCTGGACCTACCTCACAGGGGA
ATTGAGGATATTTTCATATATTAGTGTGCTTTGAAGTTGACTGAAAGATATACTGGATAT
CATAATTATATAATTTCTAAATAGATTTCTTTAAATCCATGCTATGTTTTCTTTTTCAGT
CAGGTCCTACAGAATGACTATTGCACTTGGTCTATTGTTTTAATAGTAAATTTTGTTATT
AATCTCCTATGTGTTAAACGTGGGTAATTGTATTATGTTAATACATACTTAGGGAGGAAA
AGCAGGTGGATGTAAATCAGTGATTCCCAACTTCAGCAGATGATAGCAGTGGAGGGTATC
CTTGAGCTTTTTGTAATATTTCAAAAAGTATATTAGAAATTATACATTTACCCATAATAT
TCCTGCTTCACAAGTCAATTAAGACATTGAATTTCCATTCATTTTGCCTATATTCTCTCA
AAAGCTGTGAATGGCAGTATGTTTTTGATTAATAATAAAATAAGAAATCCTATTATGTGC
AACTTATTAAATACTTGGGAACATGGGAAAAGAATAATGAAGGGATTCTTATGGTGAAAA
TGTTGGGAACCACTTTTATAAAGGAACTAAGATTATTTGACCCCCTCCACAGATTGCTTA
CCTAGTCTCTAAATAATGAAATGTGTGTGTTTGTGTGTTTTGGCTATATTAGGCTATATA
ACTTCAGGTTAGAATTTGCCTTCAGTTTTTTTTCTGTTTTAGAATATCACTGGCCTAATT
TATTTAGGTGTGTACATGTTGCTCATACATACACACACATATAGGATTACAAATGTGGAA
AATGTTATAATGTCATATTCTAGCATTGGACTAAATATCAATTTCTGACTCTTAAAGTAG
TTCTGTGTATAAATTCAACATGATGAATCAAGGCAATAATTTCTCAAATGTTCTTTTATT
TCTTTGTTTTTATCTCGACTTTTTATTTTCCATTTTTTCTAGTACGCAAATAGTGTAAAA
TTGTTTTAATGCCTGGACTTTGAAACAAGTAACAAGTGTTTGAAAGTATATAATCTACGA
GCGAATTTGCCCTCCTTGGACTAACCACATACAAATATGAATCTGGCTGCAAGAACAGGA
TATCCAGGTAACTAGAGAGTGGGCATTGATAAAAATATCTGGTGGAGAAGCCTAGGATTT
CAACTTTTTGTCAGAGGATTCCTGTTGGGACAGCTTTACCAGAAAAGAATAATAGCGGAT
ATGTTCATCCAAACTAAGAACTTTCATGCATCTTGCATTGTTACATAGCCTGTGGAATGA
ATTCATTTTTTCTCCCTTGAGTCCAGGAATGACTTCCCTGGAAAAACTCAATCTATATAC
AGCTGTGCCAAAATGAAGGATACCTGCCTCTCCGAAACTTTCACTGCTGCTTCTGTCATT
GTTCACTTGTCAGATAAAATTTTATTATCTCAGGATGCAAATTTAAAATAAAGTGTAAAT
CTATGTTAA

Protein Sequence

>53344 : length: 224
MSILLPNMAEFDTISELEEEEEEEAATSSSSPSSSSSVSGPDDDEEDEEEEEEEEEEEEE
EEEEEEEEAPPPPRVVSEEHLRRYAPDPVLVRGAGHITVFGLSNKFDTEFPSVLTGKVAP
EEFKTSIGRVNACLKKALPVNVKWLLCGCLCCCCTLGCSLWPVICLNKRTRRSIQKLIEW
ENNRLYHKLALHWKLTKRKCETSNMMEYVILIEFLPKYPIFRPD