ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

53335

Name

BCL11A

Synonym

BCL11A-L|BCL11A-S|BCL11A-XL|BCL11a-M|CTIP1|EVI9|HBFQTL5|ZNF856;B-cell CLL/lymphoma 11A (zinc finger protein);BCL11A;B-cell CLL/lymphoma 11A (zinc finger protein)

Definition

B-cell CLL/lymphoma 11A (zinc finger protein) isoform 2|B-cell lymphoma/leukemia 11A|BCL-11A|BCL11A B-cell CLL/lymphoma 11A (zinc finger protein) isoform 1|C2H2-type zinc finger protein|COUP-TF-interacting protein 1|EVI-9|ecotropic viral integration site

Position

2p16.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

53335

Links to epithelial mesenchymal transition gene database

53335

Links to ovarian cancer gene database

53335

Links to endometrial cancer gene database

53335

Links to iHOP

53335

Sequence Information

Nucleotide Sequence

>53335 : length: 5946
TTTTTTTTTTTTTTTTGCTTAAAAAAAAGCCATGACGGCTCTCCCACAATTCATCTTCCC
TGCGCCATCTTTGTATTATTTCTAATTTATTTTGGATGTCAAAAGGCACTGATGAAGATA
TTTTCTCTGGAGTCTCCTTCTTTCTAACCCGGCTCTCCCGATGTGAACCGAGCCGTCGTC
CGCCCGCCGCCGCCGCCGCCGCCGCCGCCGCCCGCCCCGCAGCCCACCATGTCTCGCCGC
AAGCAAGGCAAACCCCAGCACTTAAGCAAACGGGAATTCTCGCCCGAGCCTCTTGAAGCC
ATTCTTACAGATGATGAACCAGACCACGGCCCGTTGGGAGCTCCAGAAGGGGATCATGAC
CTCCTCACCTGTGGGCAGTGCCAGATGAACTTCCCATTGGGGGACATTCTTATTTTTATC
GAGCACAAACGGAAACAATGCAATGGCAGCCTCTGCTTAGAAAAAGCTGTGGATAAGCCA
CCTTCCCCTTCACCAATCGAGATGAAAAAAGCATCCAATCCCGTGGAGGTTGGCATCCAG
GTCACGCCAGAGGATGACGATTGTTTATCAACGTCATCTAGAGGAATTTGCCCCAAACAG
GAACACATAGCAGATAAACTTCTGCACTGGAGGGGCCTCTCCTCCCCTCGTTCTGCACAT
GGAGCTCTAATCCCCACGCCTGGGATGAGTGCAGAATATGCCCCGCAGGGTATTTGTAAA
GATGAGCCCAGCAGCTACACATGTACAACTTGCAAACAGCCATTCACCAGTGCATGGTTT
CTCTTGCAACACGCACAGAACACTCATGGATTAAGAATCTACTTAGAAAGCGAACACGGA
AGTCCCCTGACCCCGCGGGTTGGTATCCCTTCAGGACTAGGTGCAGAATGTCCTTCCCAG
CCACCTCTCCATGGGATTCATATTGCAGACAATAACCCCTTTAACCTGCTAAGAATACCA
GGATCAGTATCGAGAGAGGCTTCCGGCCTGGCAGAAGGGCGCTTTCCACCCACTCCCCCC
CTGTTTAGTCCACCACCGAGACATCACTTGGACCCCCACCGCATAGAGCGCCTGGGGGCG
GAAGAGATGGCCCTGGCCACCCATCACCCGAGTGCCTTTGACAGGGTGCTGCGGTTGAAT
CCAATGGCTATGGAGCCTCCCGCCATGGATTTCTCTAGGAGACTTAGAGAGCTGGCAGGG
AACACGTCTAGCCCACCGCTGTCCCCAGGCCGGCCCAGCCCTATGCAAAGGTTACTGCAA
CCATTCCAGCCAGGTAGCAAGCCGCCCTTCCTGGCGACGCCCCCCCTCCCTCCTCTGCAA
TCCGCCCCTCCTCCCTCCCAGCCCCCGGTCAAGTCCAAGTCATGCGAGTTCTGCGGCAAG
ACGTTCAAATTTCAGAGCAACCTGGTGGTGCACCGGCGCAGCCACACGGGCGAGAAGCCC
TACAAGTGCAACCTGTGCGACCACGCGTGCACCCAGGCCAGCAAGCTGAAGCGCCACATG
AAGACGCACATGCACAAATCGTCCCCCATGACGGTCAAGTCCGACGACGGTCTCTCCACC
GCCAGCTCCCCGGAACCCGGCACCAGCGACTTGGTGGGCAGCGCCAGCAGCGCGCTCAAG
TCCGTGGTGGCCAAGTTCAAGAGCGAGAACGACCCCAACCTGATCCCGGAGAACGGGGAC
GAGGAGGAAGAGGAGGACGACGAGGAAGAGGAAGAAGAGGAGGAAGAGGAGGAGGAGGAG
CTGACGGAGAGCGAGAGGGTGGACTACGGCTTCGGGCTGAGCCTGGAGGCGGCGCGCCAC
CACGAGAACAGCTCGCGGGGCGCGGTCGTGGGCGTGGGCGACGAGAGCCGCGCCCTGCCC
GACGTCATGCAGGGCATGGTGCTCAGCTCCATGCAGCACTTCAGCGAGGCCTTCCACCAG
GTCCTGGGCGAGAAGCATAAGCGCGGCCACCTGGCCGAGGCCGAGGGCCACAGGGACACT
TGCGACGAAGACTCGGTGGCCGGCGAGTCGGACCGCATAGACGATGGCACTGTTAATGGC
CGCGGCTGCTCCCCGGGCGAGTCGGCCTCGGGGGGCCTGTCCAAAAAGCTGCTGCTGGGC
AGCCCCAGCTCGCTGAGCCCCTTCTCTAAGCGCATCAAGCTCGAGAAGGAGTTCGACCTG
CCCCCGGCCGCGATGCCCAACACGGAGAACGTGTACTCGCAGTGGCTCGCCGGCTACGCG
GCCTCCAGGCAGCTCAAAGATCCCTTCCTTAGCTTCGGAGACTCCAGACAATCGCCTTTT
GCCTCCTCGTCGGAGCACTCCTCGGAGAACGGGAGTTTGCGCTTCTCCACACCGCCCGGG
GAGCTGGACGGAGGGATCTCGGGGCGCAGCGGCACGGGAAGTGGAGGGAGCACGCCCCAT
ATTAGTGGTCCGGGCCCGGGCAGGCCCAGCTCAAAAGAGGGCAGACGCAGCGACACTTGT
GAGTACTGTGGGAAAGTCTTCAAGAACTGTAGCAATCTCACTGTCCACAGGAGAAGCCAC
ACGGGCGAAAGGCCTTATAAATGCGAGCTGTGCAACTATGCCTGTGCCCAGAGTAGCAAG
CTCACCAGGCACATGAAAACGCATGGCCAGGTGGGGAAGGACGTTTACAAATGTGAAATT
TGTAAGATGCCTTTTAGCGTGTACAGTACCCTGGAGAAACACATGAAAAAATGGCACAGT
GATCGAGTGTTGAATAATGATATAAAAACTGAATAGAGGTATATTAATACCCCTCCCTCA
CTCCCACCTGACACCCCCTTTTTCACCACTCCCCTTCCCCATCGCCCTCCAGCCCCACTC
CCTGTAGGATTTTTTTCTAGTCCCATGTGATTTAAACAAACAAACAAACAAACAGAAGTA
ACGAAGCTAAGAATATGAGAGTGCTTGTCACCAGCACACCTGTTTTTTTTCTTTTTCTTT
TTCTTTTTTCTTTTTCCTTTTTTTTTTTTTTCCTTTATGTTCTCACCGTTTGAATGCATG
ATCTGTATGGGGCAATACTATTGCATTTTACGCAAACTTTGAGCCTTTCTCTTGTGCAAT
AATTTACATGTTGTGTATGTTTTTTTTTAAACTTAGACAGCATGTATGGTATGTTATGGC
TATTTTAAATTGTCCCTAATTCGTTGCTGAGCAAACATGTTGCTGTTTCCAGTTCCGTTC
TGAGAGAAAAAGAGAGAGAGAGAGAAAAAGACCATGCTGCATACATTCTGTAATACATAT
CATGTACAGTTTTATTTTATAACGTGAGGAGGAAAAACAGTCTTTGGATTAACCCTCTAT
AGACAGAATAGATAGCACTGAAAAAAAATCTCTATGAGCTAAATGTCTGTCTCTAAAGGG
TTAAATGTATCAATTGGAAAGGAAGAAAAAAGGCCTTGAATTGACAAATTAACAGAAAAA
CAGAACAAGTTTATTCTATCATTTGGTTTTAAAATATGAGTGCCTTGGATCTATTAAAAC
CACATCGATGGTTCTTTCTACTTGTTATAAACTTGTAGCTTAATTCAGCATTGGGTGAGG
TAATAAACCTTAGGAACTAGCATATAATTCTATATTGTATTTCTCACAACAATGGCTACC
TAAAAAGATGACCCATTATGTCCTAGTTAATCATCATTTTTCCTTTAGTTTAATTTTATA
AACAAAACTGATTATACCAGTATAAAAGCTACTTTGCTCCTGGTGAGAGCTTAAAAGAAA
TGGGCTGTTTTGCCCAAAGTTTTATTTTTTTTAAACAATGATTAAATTGAATGTGTAATG
TGCAAAAGCCCTGGAACGCAATTAAATACACTAGTAAGGAGTTCATTTTATGAAGATATT
TGCTTTAATAATGTCTTTTTAAAAATACTGGCACCAAAAGAAATAGATCCAGATCTACTT
GGTTGTCAAGTGGACAATCAAATGATAAACTTTAAGACCTTGTATACCATATTGAAAGGA
AGAGGCTGACAATAAGGTTTGACAGAGGGGAACAGAAGAAAATAATATGATTTATTAGCA
CAACGTGGTACTATTTGCCATTTAAAACTAGAACAGGTATATAAGCTAATATTGATACAA
TGATGATTAACTATGAATTCTTAAGACTTGCATTTAAATGTGACATTCTTAAAAAAAGAA
GAGAAAGAATTTTAAGAGTAGCAGTATATATGTCTGTGCTCCCTAAAAGTTGTACTTCAT
TTCTTTTCCATACACTGTGTGCTATTTGTGTTAACATGGAAGAGGATTCATTGTTTTTAT
TTTTATTTTTTTAATTTTTTCTTTTTTATTAAGCTAGCATCTGCCCCAGTTGGTGTTCAA
ATAGCACTTGACTCTGCCTGTGATATCTGTATCTTTTCTCTAATCAGAGATACAGAGGTT
GAGTATAAAATAAACCTGCTCAGATAGGACAATTAAGTGCACTGTACAATTTTCCCAGTT
TACAGGTCTATACTTAAGGGAAAAGTTGCAAGAATGCTGAAAAAAAATTGAACACAATCT
CATTGAGGAGCATTTTTTAAAAACTAAAAAAAAAAAAACTTTGCCAGCCATTTACTTGAC
TATTGAGCTTACTTACTTGGACGCAACATTGCAAGCGCTGTGAATGGAAACAGAATACAC
TTAACATAGAAATGAATGATTGCTTTCGCTTCTACAGTGCAAGGATTTTTTTGTACAAAA
CTTTTTTAAATATAAATGTTAAGAAAAATTTTTTTTAAAAAACACTTCATTATGTTTAGG
GGGGAACTGCATTTTAGGGTTCCATTGTCTTGGTGGTGTTACAAGACTTGTTATCCATTT
AAAAATGGTAGTGGAAATTCTATGCCTTGGATACACACCGCTCTTCAGGTTGTAAAAAAA
AAAAACATACATTGGGGAAAGGTTTAAGATTATATAGTACTTAAATATAGGAAAATGCAC
ACTCATGTTGATTCCTATGCTAAAATACATTTATGGTCTTTTTTCTGTATTTCTAGAATG
GTATTTGAATTAAATGTTCATCTAGTGTTAGGCACTATAGTATTTATATTGAAGCTTGTA
TTTTTAACTGTTGCTTGTTCTCTTAAAAGGTATCAATGTACCTTTTTTGGTAGTGGAAAA
AAAAAAGACAGGCTGCCACAGTATATTTTTTTAATTTGGCAGGATAATATAGTGCAAATT
ATTTGTATGCTTCAAAAAAAAAAAAAAGAGAGAAACAAAAAAGTGTGACATTACAGATGA
GAAGCCATATAATGGCGGTTTGGGGGAGCCTGCTAGAATGTCACATGGATGGCTGTCATA
GGGGTTGTACATATCCTTTTTTGTTCCTTTTTCCTGCTGCCATACTGTATGCAGTACTGC
AAGCTAATAACGTTGGTTTGTTATGTAGTGTGCTTTTTGTCCCTTTCCTTCTATCACCCT
ACATTCCAGCATCTTACCTTCATATGCAGTAAAAGAAAGAAAGAAAAAAAAAGGAAAAAA
AAAAAAAAACCAATGTTTTGCAGTTTTTTTCATTGCCAAAAACTAAATGGTGCTTTATAT
TTAGATTGGAAAGAATTTCATATGCAAAGCATATTAAAGAGAAAGCCCGCTTTAGTCAAT
ACTTTTTTGTAAATGGCAATGCAGAATATTTTGTTATTGGCCTTTTCTATTCCTGTAATG
AAAGCTGTTTGTCGTAACTTGAAATTTTATCTTTTACTATGGGAGTCACTATTTATTATT
GCTTATGTGCCCTGTTCAAAACAGAGGCACTTAATTTGATCTTTTATTTTTCTTTGTTTT
TATTTTTTTTTTTATTTAGATGACCAAAGGTCATTACAACCTGGCTTTTTATTGTATTTG
TTTCTGGTCTTTGTTAAGTTCTATTGGAAAAACCACTGTCTGTGTTTTTTTGGCAGTTGT
CTGCATTAACCTGTTCATACACCCATTTTGTCCCTTTATTGAAAAAATAAAAAAAATTAA
AGTACA

Protein Sequence

>53335 : length: 835
MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDI
LIFIEHKRKQCNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGI
CPKQEHIADKLLHWRGLSSPRSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFT
SAWFLLQHAQNTHGLRIYLESEHGSPLTPRVGIPSGLGAECPSQPPLHGIHIADNNPFNL
LRIPGSVSREASGLAEGRFPPTPPLFSPPPRHHLDPHRIERLGAEEMALATHHPSAFDRV
LRLNPMAMEPPAMDFSRRLRELAGNTSSPPLSPGRPSPMQRLLQPFQPGSKPPFLATPPL
PPLQSAPPPSQPPVKSKSCEFCGKTFKFQSNLVVHRRSHTGEKPYKCNLCDHACTQASKL
KRHMKTHMHKSSPMTVKSDDGLSTASSPEPGTSDLVGSASSALKSVVAKFKSENDPNLIP
ENGDEEEEEDDEEEEEEEEEEEEELTESERVDYGFGLSLEAARHHENSSRGAVVGVGDES
RALPDVMQGMVLSSMQHFSEAFHQVLGEKHKRGHLAEAEGHRDTCDEDSVAGESDRIDDG
TVNGRGCSPGESASGGLSKKLLLGSPSSLSPFSKRIKLEKEFDLPPAAMPNTENVYSQWL
AGYAASRQLKDPFLSFGDSRQSPFASSSEHSSENGSLRFSTPPGELDGGISGRSGTGSGG
STPHISGPGPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACA
QSSKLTRHMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE