ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5326

Name

PLAGL2

Synonym

ZNF900;pleiomorphic adenoma gene-like 2;PLAGL2;pleiomorphic adenoma gene-like 2

Definition

C2H2-type zinc finger protein|pleiomorphic adenoma-like protein 2|zinc finger protein PLAGL2

Position

20q11.21

Gene Type

protein-coding

External Links

Links to cell senescence gene database

5326

Links to epithelial mesenchymal transition gene database

5326

Links to ovarian cancer gene database

5326

Links to endometrial cancer gene database

5326

Links to iHOP

5326

Sequence Information

Nucleotide Sequence

>5326 : length: 6843
CCCCGACCCGGGGCCCGGTCTGCGCCAACCCGGCCCCAGATAGGCCCTGGGGTGACGAAA
ACTCTCCCTGGACCCCATACCTGTGTCTGGGGGACCCGAGGAAGCCACCGGTCCCCTCCC
TTCCGAGACCTGGAGACGCAGTCCTGAGGGTCCCCCATTCCCGACCCCTAGGCTCCCTGG
AGACCCAGATAAGGCGCTGCTGACCTTACCAGGGACCCGGGTCTGGGGGACGCAGATAAG
CTGCACCTGCTCCCTCCCTCCGACACGCCTACCCAGACCCACATAACCCCCTTTCCTGCT
CCAGATAGCCCGCTCTGTACCCTGTTTCATTTTCCAGACTTACATAACTCCCTTTGAGGC
TTCCCTCAAATATCTGGGTCTGGAGAAGTCGAATAAGCCCCACCTGTAGTTCCCTCCTCA
GTGGCCATACTCCCAGGCTTTCGACATCTTCCATCCCGTTACCCATTTTGAGACCCTCTT
GAAATTCAGAGGATACACTTCTGACTATCCCCATCCCCCCAGCCTTCCAGCCCTTATAAT
CCCCCATTTCATTCTTGTGGGGATCCCTTAGAGACCCAGGAAAGTTGCTCATGATTCCTT
CCCATCCTCGCTCTTCCTTCCCATCCCAGAGACTCCCTCCAGACTTCTCCCTGGATTTCC
TTTGCTTCTCCAGCCCTCATCCACTCCCATCTCTCCCAGGCTCGGGGAATTGAACCTTTC
CCACACCACAGTGGGGTGATCTAAAAGTTGGCCTGGGACCAGGCTGTGGCCCACCTTGGT
GGGGAGAAAGGGGCCTGTTAGGTGGAGGATATGGGGACACCTGTGTGGGGGAATCGGTGC
TTTCACCTGCAAGCTTAGCCTGTCTCCTGGCTTGTGTGTTTTTCCACCTGTCAGCCATGG
GACTGTGTGTAGAGTCTGGTCTTGGGTTTCTAACCTTTCTCTCCTAAGTGTTTCTTCAAC
AAGAGGAATGGTTCCTGAACAGGACGTAGCTCATGTTAATGATGAGCAAAGCTCTCTGGG
GCATGAACCCGCTGATCCCATCATCTTGTTCACGGCCAGTCTGTTGGATGAATGGTCACT
GTAAGCAGCAGGTGCTAATGAGCTGAGCAAGCATTCTGTGGCCCACAGCTAGTTTGTGCA
GTTGGAGCCCTCCCCAGATTCTCGTGGATAATCCCCAGACACCCCCTTTTCTCTCTTCAC
ATGGAAAAGCCTCATGATCAAATTTTGGCACCATCTCTTCAAAGGGAATCCCCCTGTTGT
AGCAGGTTGCATCGTGGTTGGTAATCTGTGGTGAAGAGATTGTTTTCTGAAAGCTGCGTT
GGAGGCTGTGACAGAGCTGAGAGCCTGTGTGGAGCGGATGGGGAGGCTTTCTCAATAACA
TGGCCCTTTGCCATTAGCCTTGCCATGACCACATTTTTCACCAGCGTCCCCCCCTGGATT
CAAGATGCAAAGCAGGAGGAGGAAGTGGGCTGGAAACTAGTTCCCAGGCCTCGGGGCCGG
GAGGCGGAGAGTCAAGTGAAGTGCCAATGTGAAATTTCGGGAACACCTTTCTCAAATGGG
GAGAAGCTGAGGCCTCACAGCCTCCCGCAACCAGAGCAGAGACCATATAGCTGCCCTCAG
CTGCACTGTGGCAAGGCTTTTGCTTCCAAATACAAGCTGTATAGGCACATGGCCACCCAC
TCAGCCCAGAAACCCCACCAGTGTATGTACTGTGATAAGATGTTTCACCGCAAGGACCAT
CTGCGGAACCATCTGCAGACCCATGATCCTAACAAAGAGGCCCTCCACTGCTCTGAGTGC
GGTAAGAATTACAATACGAAGCTGGGCTACCGGCGCCACCTGGCCATGCATGCTGCCAGC
AGCGGTGACCTCAGCTGCAAGGTGTGCCTGCAGACCTTTGAGAGTACCCAGGCCCTGCTA
GAGCACCTGAAGGCCCACTCACGCCGGGTAGCAGGCGGTGCCAAGGAGAAGAAGCACCCC
TGTGACCACTGCGACCGGCGGTTCTATACTCGTAAGGATGTACGGCGGCACCTAGTGGTG
CACACAGGCCGTAAGGACTTCCTGTGCCAGTACTGTGCCCAGCGGTTTGGCCGTAAGGAC
CACCTGACGCGTCATGTCAAGAAGAGCCACTCGCAGGAGCTGCTCAAGATCAAGACAGAG
CCCGTGGACATGTTAGGCCTACTCAGCTGCAGCTCCACAGTCAGTGTGAAGGAAGAGCTG
AGCCCTGTGCTGTGCATGGCCTCTCGGGACGTAATGGGGACCAAGGCCTTCCCTGGCATG
TTGCCCATGGGCATGTATGGTGCCCACATCCCTACCATGCCCAGCACGGGCGTGCCACAC
TCCCTGGTGCACAACACGCTGCCCATGGGTATGAGCTACCCTCTGGAATCCTCACCTATC
TCTTCCCCAGCTCAGCTCCCTCCAAAATACCAGCTTGGATCTACCTCATACTTGCCCGAC
AAATTGCCCAAAGTGGAGGTGGATAGTTTTCTGGCGGAGCTTCCTGGAAGCCTGTCTCTC
TCATCCGCTGAACCCCAGCCCGCCTCACCTCAGCCGGCGGCAGCTGCGGCCCTCCTAGAT
GAAGCACTGCTTGCCAAGAGCCCCGCCAACCTCTCTGAGGCCCTCTGCGCTGCTAATGTG
GACTTCTCCCACCTACTGGGCTTTCTTCCACTCAACCTGCCCCCGTGTAACCCACCTGGG
GCCACAGGAGGCCTGGTCATGGGCTACTCCCAGGCTGAGGCACAGCCCCTGCTTACCACT
TTGCAAGCTCAGCCTCAAGATTCCCCAGGAGCTGGGGGACCACTGAACTTTGGGCCTCTG
CACTCCTTGCCTCCTGTCTTCACGTCTGGCCTGAGTAGCACCACCCTGCCTCGTTTCCAT
CAAGCATTCCAGTAGCCCCCACAGAGGCCCTCAGCTCAGTTTTTGGCTCTGTTATGGAGC
CTTAGTACCCACCCCGTCTGTGTCCCCCATGAAGGCAGCTGAGCTTTCAGAGCTGGGTTC
AAAAAAAAAAATTCCAGTGTCTGTATACAGGAGCACTTGGTTTGGGGGTTCAGGCTCTAG
GATCGATTCCAGAAGGAGCCTTGAGCCCCAACCCCGTGAAAAGATCTCATACCGTAGGAC
TTCAGGTATTATTTACTTTTATTTTTTTGACCTGAATCGGGAGCCACACTTGGCCCTCTT
CCTCTCCAAAGCGCCAGAACCTCCTTCTCTTTGGAGAATGGGGAGGCCTCTTGGAGACAC
AGAGGGTTTCACCTTGGATGACCTCTAGAGAAATTGCCCAAGAAGCCCACCTTCTGGTCC
CAACCTGCAGACCCCACAGCAGTCAGTTGGTCAGGCCCTGCTGTAGAAGGTCACTTGGCT
CCATTGCCTGCTTCCAACCAATGGGCAGGAGAGAAGGCCTTTATTTCTCGCCCACCCATT
CCTCCTGTACCAGCACCTCCGTTTTCAGTCAGTGTTGTCCAGCAACGGTACCGTTTACAC
AGTCACCTCAGACACACCATTTCACCTCCCTTGCCAAGCTGTTAGCCTTAGAGTGATTGC
AGTGAACACTGTTTACACACCGTGAATCCATTCCCATCAGTCCATTCCAGTTGGCACCAG
CCTGAACCATTTGGTACCTGGTGTTAACTGGAGTCCTGTTTACAAGGTGGAGTCGGGGCT
TGCTGACTTCTCTTCATTTGAGGTCACATTTTTCCCCCGTGGGGAAATAAACTGACTTTG
GACTGCTTCAGTCTCTGCCATCTTCCATGACTGCATTTGTTCCTGCCTGCCTCGGCGGTA
TCCACAGAAGACAGGCAAGAGGATTGGAGCAGTTTTCTCACAGGTCTGCAATTCTGTTTT
TCTCCAAGTACATTATGACCCCCTCATCCTTCTCTTGAACTGGAGAGGGGAAGAAATGAA
AGGCATGCCCACGTCCGTCACCTCCCCATCCCCTAGTCCCCACCTTGAACATCATGAGCT
GTTGTTATTAGTCTTGGAAGCAGAGTCTGGGTTGGTGTGGATAGCAAAGGAGGAAGTCTG
AGCCCCTCATTGGTCTTCCTCCCACCTGTCCCTTTTCCGGGAAGTTGTGGAATTGTTGGA
AGAAGAGTTTGCAGAAGGTTAGGAATGGGTAGATAGCTAAGTCCTAATCTATGGGTACAT
TGTTGTGTCCCAAACCAAAATTTTCCTTATCCACAATGTCCCTTCTGTCTCTTCCACTTT
ACAGTGGACTCGGCCACTGTGCATAGGCTTCTCTGCTCTCCATCAAATCACTTCCACTTT
CCTGTGCCCCCACCCCCGCCTCCAGTTTTCCGCTAGTATCCGGCAAGGTTTCTTGCAACA
AATGATTAGTTCTTTTCTTCTGACTCGTGGGGCTCCCTGCTGCAGAGAGCACAGCCCTTG
CCTGGAGCCCAGGAACCCCATCCTTGCTTCATCTCAGTTCTTCATGGGCTTCACTCTTCC
CACTCACGGAAGGGAGGTAGCTCAGGGACCTCCACTGTGGGACCCTTGAGACGCTTCCAC
TCTGATTCAGAAACACACTTCTACCTCTTTACTGTTAACTCTTAACAGATGCAGTCAGCA
GTTTCTGGGCACTTCTCTCAGTAGGTGCCTCATGCTGACTTCTCCAGTAGGGTTTCAGGA
CAAACTACCAAGGAATTGCCTCAGCCTCCTACCAGTCCTCCCTCACCCACCTTCTGTCTA
GGTTCACTTGGTTTGTCATCAGGAACTGAGCAGGTCCAGGACTCAGCTTTCTGCTTCAGC
CTAAGCCAGTACTCCTTGTTTGAGGTAAAAGCCTTAAAATTTAGCTCCCTAGCTCTTGAT
TAGAAGCAATTTGGAGTAAGTGTGTTTTGATTTAGGCAGGGTAGCTTGGGATACCTTTTT
AAAAACACCAGATATTAAAATGTCTGGCAAGGTTAGAATCAGACTAGATGATTTGCTTCT
AAAAATTAGTTTCAGTGAGTCCCAGGGACTAATTAAGGTTTATTTTAAAAAGTGTCTACC
TTGGTACGCAGCCACCTCCTGCATGCTGTGCATGTTATTGGGACTTGTATTATAGGTGAT
GGTATGTGAGAATCCAGTTGGGACTCGCTGTTGCCATCCTCTTTGTTGTATCTGGTTTTC
ATCACTAGACTCAGCAACCCTTCTCACCTTAACTGCCACCTTCCCTACACTCTCAGTTTA
CAGAGGCCACTGGGCCTCTGGCTGCAGAATACAAAGTCCCGGGCTGTTAGAGGAGTCCTT
TCCTCTCTGCCTGCCCTTTCCTGTCCCTCCCTCGAATTCTCTCTCCCCGTAAGTGATGCT
GGAAAAGTCATAGGACTGGCAAAGCAACTGTTTAAACCCTTTGTAACCGGGGCCTTGCCC
CCACCTCCTGTCTTTTCTCCTTGCCTTCCCCACTCCTGTGTCCTCCCATCTATCCTGTCT
TTCCTTTCCTCCTCTCAGTGTCCTCAGCACCCACAAGGAATTTTCCTATCACTGTGAACT
TTGCTGGTACAGAGGAATAATATCTGCCTTCACCTTTTTTTTTTTGGACCATAGCTAGCC
AGTCATTTCTTAAACCTCCCTTCCTAAAATCTGGGGGGTCGGGGGGAAAGAAAAAAAAAG
CCTTAGTGGCCTGGTTGTTCAAAGGATAAGAATAGCTTTATCCTGCACTCAGTACCCGAA
CTCACTTCAGTATGCTTACTGAGGCCATGAGAACCTGAGGGGCATCTGCCCAGGACAGGA
GCCATGGCATATGACAAAGACCAATGAGGGACCAGGAAAAAAAGTGATGTCCCCTTTCCC
TGCCACCTCCAGCCTCTGCCAGCAATGAGCTGTCCCCCTCCCACCCTACACAGTAGCTGG
TCAGGGCTGAGTACAGTCCTGGGGGTAAGGGGATGACATGCCCAGGTGTCAGCTCAAAGG
ATCTCTGCATCATCTTGAGGTGGGAGGCAGGGAAAGGAGCGCCAATGAGGTTCCCTGCAA
CCCCCGCCCTCCAGCCCACCGCCCAACCTTTTACAAATGGCATTTTCTTAATTGAAAATC
CGGGAAGCAGGTGTGATTACTTTTTTGCTCGTAGATATTGTCCTAAGTTGGAATTCTCCC
ACTGCCCTAAAACTTTCCCTAGTAGTCCTTTAAACTCCCCCCTCCCTTTTTGGTAGCTGT
TTTCTCCGTCCTCTCTCCACCTGCCCTCTTATCTAGGAGCTGTTTGTAAGCACGATTTTT
TTAACAGGTTATATTGTACAGGATCAATATTTTGCTTTTTAACAAGGATATTTATGTAAT
AAGAAACTTTGCCTTAGGCAGGTGTTGGCCAGAAAAGTCCAGATTCCTCTGGGATCCCAC
CCTGGCCTCTCCTGGAACTCTGAACCTGCTGTGGAAGGAATTGGCCATGACCTTCACCTC
TGGAGAGTAGGGTCTATGGCGAGGGAAAAGGGTGTTCACCATGATAACCTAGTGCCTCCA
TAGAGGGGTTTGGAAAAATTCCAGTCCGATTTCTTTGTGTGTCAGCTGACTTCCTTAGCT
GATTGTTCCCACTTGCACCTCTCCACCTTTGGCACTAGAACTCCTGAGACACCACTTCTC
ATGCTTCTCCCTCCCTACCAGCGGTCAAGGCTTTGGAGCCACTCTTTTGTAACTCCAGAT
TATTTAAAGAGAAAAGTACAAGACAGAAATCTTCTAGCACTTTGTAAACACAGTGAATAA
CCTCTTGGAGTATTTTTGGCTTTATATAAAACAAGGTTTTTAATTGTAAAGTATAAGTGC
CATTAGAAAATGCACAGGGCATATCTTTGTTAAAGTAGATTTTTCAATGTTTTACAGAAT
TACATTTTCAAAAAAAGGTTTTTATAATGAAGTTGTTTATTAAAAACTTCTGAATGATGT
GTT

Protein Sequence

>5326 : length: 496
MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSL
PQPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTH
DPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSR
RVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKK
SHSQELLKIKTEPVDMLGLLSCSSTVSVKEELSPVLCMASRDVMGTKAFPGMLPMGMYGA
HIPTMPSTGVPHSLVHNTLPMGMSYPLESSPISSPAQLPPKYQLGSTSYLPDKLPKVEVD
SFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAKSPANLSEALCAANVDFSHLLGF
LPLNLPPCNPPGATGGLVMGYSQAEAQPLLTTLQAQPQDSPGAGGPLNFGPLHSLPPVFT
SGLSSTTLPRFHQAFQ