ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5324

Name

PLAG1

Synonym

PSA|SGPA|ZNF912;pleiomorphic adenoma gene 1;PLAG1;pleiomorphic adenoma gene 1

Definition

COL1A2/PLAG1 fusion|zinc finger protein PLAG1

Position

8q12

Gene Type

protein-coding

External Links

Links to cell senescence gene database

5324

Links to epithelial mesenchymal transition gene database

5324

Links to ovarian cancer gene database

5324

Links to endometrial cancer gene database

5324

Links to iHOP

5324

Sequence Information

Nucleotide Sequence

>5324 : length: 7338
AGCTGCAAGTTGGGCTGCAGGGGCAGCGCATACACTACAATGGCTGCTGGAAAGAGGCGT
AAGGAAACAATTTCCAGGCCCGCCGCGTCCAGCCCGAAATATGAGAAAAAAATTATTAGA
AATTCCGCGGGCGGTGTAGAGGCGGCGGACGGGCCGGAGGGAGGATGTTAAAGCCCCGCG
GTTGCCTCTTGGTGCTGCCTTGGCCGTATTTGGCACCCAGAATGCTTCATTCTGTGACGG
TCTATTAATAAGGTTGCCTTGCTAGAGTTTGGAGCAGGGCCTCAGATTGGCCAAAATGGG
AAGGATTGGATTCCACTCTCTTCCACGAAGAGTCAATGGGACTGGCTAAGATCAAAGTCT
GAGGCTTTTTCCATCAGTAATCAGTCCCTTTTTGCTTTCTTTTACGACCACATGAAACTT
GAGAAGCCACCTAAAGCTATATCATTTAGTGGAGTTGGGCAGTTCCCAAGTGTCCAACAA
GAAGGCCTGGTTTAGGCTGCGATGGCCACTGTCATTCCTGGTGATTTGTCAGAAGTAAGA
GATACCCAGAAAGTCCCTTCAGGGAAACGTAAGCGTGGTGAAACCAAACCAAGAAAAAAC
TTTCCTTGCCAACTGTGTGACAAGGCCTTTAACAGTGTTGAGAAATTAAAGGTTCACTCC
TACTCTCACACAGGAGAGAGGCCCTACAAGTGCATACAACAAGACTGCACCAAGGCCTTT
GTTTCTAAGTACAAATTACAAAGGCACATGGCTACTCATTCTCCTGAGAAAACCCACAAG
TGTAATTATTGTGAGAAAATGTTTCACCGGAAAGATCATCTGAAGAATCACCTCCATACA
CACGACCCTAACAAAGAGACGTTTAAGTGCGAAGAATGTGGCAAGAACTACAATACCAAG
CTTGGATTTAAACGTCACTTGGCCTTGCATGCCGCAACAAGTGGTGACCTCACCTGTAAG
GTATGTTTGCAAACTTTTGAAAGCACGGGAGTGCTTCTGGAGCACCTTAAATCTCATGCA
GGCAAGTCGTCTGGTGGGGTTAAAGAAAAAAAGCACCAGTGCGAACATTGTGATCGCCGG
TTCTACACCCGAAAGGATGTCCGGAGACACATGGTGGTGCACACTGGAAGAAAGGACTTC
CTCTGTCAGTATTGTGCACAGAGATTTGGGCGAAAGGATCACCTGACTCGACATATGAAG
AAGAGTCACAATCAAGAGCTTCTGAAGGTCAAAACAGAACCAGTGGATTTCCTTGACCCA
TTTACCTGCAATGTGTCTGTGCCTATAAAAGACGAGCTCCTTCCGGTGATGTCCTTACCT
TCCAGTGAACTGTTATCAAAGCCATTCACAAACACTTTGCAGTTAAACCTCTACAACACT
CCATTTCAGTCCATGCAGAGCTCGGGATCTGCCCACCAAATGATCACAACTTTACCTTTG
GGAATGACATGCCCAATAGATATGGACACTGTTCATCCCTCTCACCACCTTTCTTTCAAA
TATCCGTTCAGTTCTACCTCATATGCAATTTCTATTCCTGAAAAAGAACAGCCATTAAAG
GGGGAAATTGAGAGTTACCTGATGGAGTTACAAGGTGGCGTGCCCTCTTCATCCCAAGAT
TCTCAAGCATCGTCATCATCTAAGCTAGGGTTGGATCCTCAGATTGGGTCCCTAGATGAT
GGTGCAGGAGACCTCTCCCTATCCAAAAGCTCTATCTCCATCAGTGACCCCCTAAACACA
CCAGCATTGGATTTTTCTCAGTTGTTTAATTTCATACCTTTAAATGGTCCTCCCTATAAT
CCTCTATCAGTGGGGAGCCTTGGAATGAGCTATTCCCAGGAAGAAGCACATTCTTCTGTT
TCCCAGCTCCCCCCACAAACACAGGATCTTCAGGATCCTGCAAACACTATAGGGCTTGGG
TCTCTGCACTCACTGTCAGCAGCTTTCACCAGCAGTTTAAGCACAAGTACCACCCTCCCA
CGTTTCCATCAAGCTTTTCAGTAGGATTCTGGGACATGGATTCATTACAGAAATGTATGT
GTAGCTGTGCCCTAGATGACCATTTTTATTTTAGTGCCTACTTTAAAACAGTATAAAAAT
TTCTGCTTTTGTATAATACAAATTTTCATTAAGCCAGTATAAAATAGAAACTAGCTTTTA
AACTGAGCTTTGGAACCATTTGTGTTCAGTTAAGTTTACCTGGGTATTTTGTCCTGATTC
ACTGCCAATTGTCACATTTTAAGACTTTTTTTTTTCCATATAGGAAAGCCATTATTAGTA
GTAAACTTTTACAAATCCCATTTTCAAATTACTTTTAGATCTTAAAATTTTCATTTTTGT
CTAATAACAGTGGCTCTACCTTTTGACATCTGGCTCATTAAAAAATTTAGCAATAGAATG
TAAATTGTATAAAAAGTTTGTGAATAACTCAAGGGTTTAAATTTTCTTACTAGCTTCTAA
ATGGATTAATAATCAAGTGCTTCAAATGAATTAAGAGTCCAGTTTCGGAAGATAATAAAT
GTTTGTTAGATACACCATAATTTCAGATCAGTATATTCTGAAGACTCCCTGTTGTCTGGC
TAAAATATTTGCCATCTTTATTATGAGCCTTTAAGGAAAACAAACCCTAAACACAAAGCA
TCAGTATTTATAGCAAAAAGAGACTCTGTTAGGTGACATGGCATTTCGTGTCACTTAATA
GTTGGCCCTAAATTAGTACACAGGATATTTTGTCGTGTTTCATCCTTCTTAACATGCTAT
CTTTTCATTTAATAATAGTAATAGTGTATGGCATTGGGGTCTTCAGAGTCGATATATAGG
TAGATCTCTTTAGTCTTTTCCACCTTTCACATCCAAGGGGTGGGTCAAGTGCAGCCAGCA
ATTTATTTTCATTGTTGGCCCACGGTTAGTCCATAATCTAGAGCCATTGTGGAACTGCAG
CCATGAGGTGTGTTTATCCCACAGTGGATTGACTCAGCCTCTGTGGGTGACAGACTTCTA
AGCAGGAAGATAGACGTGAAGCACATGGTTACATTTGGGAACTTGTGTAGGGATCATGGC
CCCTGTAGCCAGGGTTAAAAACTGGACTTTTTAGAAGTAAAGTAAAAGCATATCGCTTAT
ATCATTTCTTGCTGAATTTGATATGTTTTTCTTTCCCTTAAGAATCAAAAGCAGAAAACA
AAAACAACAGTCCTACTCCGATGTTATCTTTCTGATTCAATGTGAATCCATCTTTCCTTG
CAATATTTTGGATGGAGAATTTGAAGTTAAATGCATTAGAAAACTACCTGATGAACTACC
ACAAAGTTTTAAGTGACTAGAAATATATACAGTAAAATCCCACTTTCATGCATCTCTGGG
AAATGATAGGAGTATTGCAAATAAGTTGAGTTTGTAGAGGGTAACAAAGTAAAGTAAAAC
AAACCTATCTTGGTTAACATGAAAATAACAATTGAGAATATATTATATTCACTGAATAAT
TATAGGCTTTTCCTCACATTAGACAACCAACATAATCTTCTTAAAGGTCTAATTAATATA
TTTTTCTAAGGGTCAGTTGGGACATTAACCTAAGAAACATATCTATTAAGCACTTGTTAA
CACCTTATTTTAGGACCCTTTCCGTTGGGGATGGGGGCAAGGGTGGGAGGTTTTTAGAAG
AGTATATATCTCTTTAAAAAAAAACAGAAAGAAAAATATTTCTGAGCACTCATTAGCCCT
ATATGGAAACTTCTTTCCTTTTTGTAGGGCCAGTTATCACTGCAGATTGCAATGTTTACC
AAGAATTTCTAAAAATGAGTGCAGATTACTGAATATAATACATTATTTAAAATATTTGGG
AGTAGTATAATTTGTGGAGAAATGTAAATTGTAATAATGTAAATGGGGGCTTCAATATAT
ATATATAATACACACACACACACACATGCACACATACCGCACTTCATAGAATCAAAGTTG
CTCTCTGAAGGAGCTTTGGCTCCTGATATTTTATCATGCTCCTATATTTTTTTAATCCTT
GGAGCAGTAGTTTTTATACTTATGTATTTAAATTTTATTATGAAAAATTACATTTATTAA
AAAAGTGTGTTCCAAAGGCATTAAAATTATATATGTTAATAAGGAAGTACATTTTTAAAT
TTTTCAAACTGCTCCTAGCTTTTGATTAGGAGAATATTTTTTCTGAAAGTAGGCTTTTCG
CTCTGCTTCATTACTGCTTCCTTTAGTTTCTATGAAACAGATTGCTTACCTAAATCTTTA
GTTGAATGATTAGTGTTCAATATTGCTTTAATCACCATATAAAAGGAAAAAAATTGGTGA
CAGAGCACAAATAGAAAACCTATTTTTAAATAGAAATCACAAATAGCAAGTGTGGAAGCA
CTACTTTATTCTGTTTAAAATGTACTTAAGAAGTCATCAAATTAGTGAACTGAGACATTG
GCCTTAGTAGGCTGTATTCACTGCTAATTTAAAAAAGGGAGTACCAGGATTTATTAAGTA
AAGCATTTTGGAAATGGGGAATAGCGCCATATATGTATGTATGTGTATGTGTGTGTGTGT
GTGTGTATATATACACACACACACACATACTTAAATCTTGCCCTGCATGAAATTCAAATA
CATGGAGGCACATCTTCAGGGCACCAGTGTTAAAATTTTGGAGTCTTAATTTTCATGTGT
ACACCTCTTTGCCTGTTCCCACCCCCAGACTTGAAATAACACTTCAGAGTAAGAGGGAAT
TCAGCTAATTTGTTTTTAAAATTGACTGTAGTGGTCACTAAACCCTTTTTGAGAGAATTT
CTATTAAAGATGAGGCAGACTCGCTTATTTGAATTGCACAATGTTCTAACAAGGATGTAA
CACAGAATTGGCTTTTTTTTCCCTAGAAAAAGATTGTTTGTTTCTATGTCAACTAGATAT
GATTAAAAATAAGTATTGCCAATGCTGTTTTCATTCTCTAGTGGCCAGAATCATTATCCT
TGAAATTTCTGGTAGTGCCTTAGCTTGGTTAAAAAAAAAAAAAAAAAAAAAAAAAAGGGA
TTAACATTAAATAAAAGTAGTTTAGAATTTGGGCCTCAGACAAGATATTGAACCTCATTC
AGTTTCACTTCCACATGTATGTACAAGTTAGGTCACCAAACACGGAAGTGTGAGTGTGGA
AGGATCTTGGCACTGTAAGCAATGCTATCCATTGATGTATACAAGTACCTTTATAGTTAT
CGATCACTGTTAAAACTTTCATTTTAAAATCCTATTACCAAGTTCAGTTTTTTAAAACTT
CAATTGTCCTGGCTGATTATGCATCACTCTGTGTGCAACTTTTTTATTTCATTTAGTGTT
TCTTTCAAGCTGTGTATTTTTGCCTATTTGTTGCTTGTGCTTTATTTTTCTTAGTCATTT
GTGGAATATAGTGATATATTGTGTTAATTTGGACAGTAGCGGTTTTTAAAAACCATATAC
TGACTGAAACATGAGCCAGAGCCGATTGCTTTATTAAGCTAATAATGAATGTTAAAGAGT
ACATATTTTCAGGATCGTTCATCTAGTGAGCAATACACATATTATAGGCCAATATTTTTT
TAAAAAATAGAGCTTGGTCAACCTCTATACTACACATATTACAAGATATAGCACTTTCAA
AATGAATCTAAACCTTTACAGAAACTTTCTTATAGGTTATGCCTTTTATTTTAAGACTTA
TTATAATTCAAGTGCCATTAGATGATATATATGTAGGCCTTTGATATATAATGCTTTGTG
TACAAAAATGGTAGATGGTATTTTAAACAGGTACATTTTTACAGTGTTTTCTTATCAATT
TGCTATATTGCACAGAATCAGTGTGTGTCTTTTCATAAGGTTTTACAATGGTTTATTTTT
TTACAAGGTTTACGTGTCTCAAAGCACACTGTCTTCCCAGTACGTAAGTTAAAAAATACC
AGTTCACCCAAGTTGCTTCTAGCCTACTGAGATCCATGTGACATTGGAGGAGATCTTTTA
AATGTTTAGTATTCGTCATTAGCAATGGCTGGCTGTTAGTTCTGGTAAATGTGTGCCTAA
GTTGAATTTGTCTTGTTTTTCTCACACTGTGTCAGCAGCCATGTCTACAACACAGATAAG
TCTGTTGTGATCACATAGATCTACATAAGTTGTGCAGTTTTGTGCTAAAAACCCATAGGG
AGCTCCTTTGGGATCATAGAAAAGAAGATCATGCAACCAGCATTGGTGAAGGCACACTCA
GATTGCACTTAGGGCCTTTCTATGATGTTGTCAACCCTCTGAGGATGGAAGGCAGTGTCT
TTTGATGTTATCTAGCCTAGAAATGACACAGAACTATTGCTAATGTATAAAACACTTCAT
TATATAAGCTTCAGTGGTACAGATGAACCAGAATGAATGTTTATCTTCTCAGAAACACTC
CTTCAATATTATATTGGATCATGCTGCTAATGTAACTTGGGCTACAACTCTTCATGGTGC
TACAAACTTCTCTGTCTCATTCAGTCGTATTTTTTTATCCATAGAAAAAGGACTACATTA
GGTGTAAAAGTGTACAATATATTTTTATACTGTGACTTAATTTGTCATTAACAAACTTTT
ACACCACCACAATGTATTCATGTGCACTTGCAAAAGGAGATCTCGGACATGCAAATGTTA
CCAGAACAAACCCAGCTTTTGTCCACAAGGTGACTGTAACTCAGAATGGAAAGTGGGCTT
TATAATAGGGTGTGGAGTGAAGAACATGCTGTATGTTACTAACAGCCCTTTGAATTTAAC
AAAAACTGGGAATCCATTAGGAAACGGATTGCATCATACCTGAACATAAGCTGGACTGCT
GAAATTGTATTTTTAGCTAATGAAAAAGTGTTTGGACTAGTACTCTAAAAATGTTCTAAT
GATAAAGTTTTGAGTCAAAATAGAAAAGAAAAAAATCTGCATTCCAGGCCGAATTTTGTA
TATTTTTATTGCATTTAAAATTGCTATTCTGTAATATTGGGAAATCAAGTGGCTTATCAT
GTATATCGTGTACTTAAAATGTATTCACAAACTACTGTTGTATTTGTATAAAATATAGAC
AAAGATCATATTTTTTGTGTGTGTATAAGCTCTGTAAAATAGCAATCACATTATGAAGCT
GCAGTGATACTACATTTTAAACATTCACATCCAAAGAAGCAGACTATTTATTGTCCATAT
ACCAGATTTAAAATATTAATTTGCTGCTAATTAAATAATAGTACTGCAGCTTCTTGTGGC
CTACAGTGTTATGTTTGCTGTAAGAATAAGATATGTGAATTCCACAAAATATATGAATAA
AATTATAGAATGGCTTTA

Protein Sequence

>5324 : length: 500
MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGER
PYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKET
FKCEECGKNYNTKLGFKRHLALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSSGGV
KEKKHQCEHCDRRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQEL
LKVKTEPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQS
SGSAHQMITTLPLGMTCPIDMDTVHPSHHLSFKYPFSSTSYAISIPEKEQPLKGEIESYL
MELQGGVPSSSQDSQASSSSKLGLDPQIGSLDDGAGDLSLSKSSISISDPLNTPALDFSQ
LFNFIPLNGPPYNPLSVGSLGMSYSQEEAHSSVSQLPPQTQDLQDPANTIGLGSLHSLSA
AFTSSLSTSTTLPRFHQAFQ