ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5308

Name

PITX2

Synonym

ARP1|Brx1|IDG2|IGDS|IGDS2|IHG2|IRID2|Otlx2|PTX2|RGS|RIEG|RIEG1|RS;paired-like homeodomain 2;PITX2;paired-like homeodomain 2

Definition

ALL1-responsive protein ARP1|all1-responsive gene 1|homeobox protein PITX2|paired-like homeodomain transcription factor 2|pituitary homeobox 2|rieg bicoid-related homeobox transcription factor 1|solurshin

Position

4q25

Gene Type

protein-coding

Pathways and Diseases

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

multi-step regulation of transcription by pitx2;PID BioCarta;100074

Disease

Atrial Fibrillation;GAD

Disease

Axenfeld-Rieger syndrome, type 1;OMIM

Disease

VISION;GAD

Disease

CARDIOVASCULAR;GAD

Disease

Atrial fibrillation/atrial flutter;GAD

Disease

Peters anomaly;OMIM

Disease

Iridogoniodysgenesis, type 2;OMIM

Disease

Corneal disease;FunDO

Disease

Atrial fibrillation/atrial flutter;NHGRI

Disease

Rabies;FunDO

Disease

Peters' anomaly;GAD

Disease

Rieger syndrome;GAD

Disease

Atrial fibrillation;NHGRI

Disease

Ring dermoid of cornea;OMIM

Disease

Glaucoma;FunDO

External Links

Links to cell senescence gene database

5308

Links to epithelial mesenchymal transition gene database

5308

Links to ovarian cancer gene database

5308

Links to endometrial cancer gene database

5308

Links to iHOP

5308

Sequence Information

Nucleotide Sequence

>5308 : length: 3482
GCAGTCTGTGTAAGTTTTCATATCTCTGAGTGTGTGCACACAGTGGAGAGGGTGGAGCCT
GCCATCCTCAAATCTGAAAAGATTGAGAGATTTCAGAGGGCCCAGATGTGCCAAAGGTCA
GAGGGATCAATATACAGGCCCTACCACGGAAAGGCGGGGAAAAGGTTCGAATAGAAAACT
GCTGCAGAAGGGAAGCCACTGAGAGGAGCAAATGTGGACTTGAGGGAAACTCTCTCCCCC
ACCCCCACTTCTATCCCGTGCAATTTAATACCATCCTCGCCAGGAACCTTAACCTCGTCA
TTTTAAAAAATGAGATATCCGTGACCCAGGGTGAACTTGTTGAATGTAGGTACAGCAGAG
GAAATTCTAGACTCTATGAGCGTCTGAGCCTTGTCCAGTGCAAACCCTTCGTGAACACTG
GGTCAGTGCGTGGCCGTGCCCACCTGTGCGCCGACACTCTCAGCATGCCTGGTCCACCCG
CCTTGACCTCGGGCGCGGTGTCCCAGCTAAGCTGGGCCCAGCGTCCCGGCCTTCCCCAGC
TGACAAGCCTAGCTCGTTCGCTCCCGGCTGTGGCCCTCCCACCCTCTCCCACTAGCTCAC
TCCATTCTTCTAGATTTCTCTTCACTCATCCTCTCCCATCCCCACCGCGCCCACCTCCAC
TCCCGCCCTCTACCGGTCTCTCACTTTCCTCCCTCCGCAGTCCCTCTTTGCTGTGACCTC
TTTCCTCAACTCTGCAGGCCTGAAAGAAGGTCACACACGCACGCTCACACCCACACTCCA
CACGCCTCGTCCCAAACAACCCCATGAACATTGTCCTTTGTTCCGTCTCTTGGGCCACTT
TCCCTGTCGCTTCCTCCCAGCCCGTCCTGATTTGCTCCCCAAAAGTACGTTTCTGTCTCC
CCGCTGCCCTGGCGCTCCCCCTTTGATTTATTAGGGCTGCCGGGTTGGCGCAGATTGCTT
TTTCTTCTCTTCCATCCCATCCTCCCTTCTGGTCCTCCTTTCCACAGTGGGAGTCCGTGC
TCCTGCTCCTCGGTTGGCTCCTAAGTGCCCCGCCAGGTCCCCTCTCCTTTCGCTCTCCCG
GCTCCGGCTCCCGACTCTTCGGCCCGCTGGCATCTGCTTCCCTCCCCTGCCTCGTTTCTC
GTCGCCCCTGCTCGCTCCCCCCGGCGCTCGCCCGGGCGCTGTGCTCGCTCCTGGATCGCC
AGCCGCGCAGCCGGGCTCGGCCGGCCGCCCGCGCGCCACTGTGCAGTGGAGTTTGGTGGA
ATCTCTGCTGACGTCACGTCACTCCCCACACGGAGTAGGAGCAGAGGGAAGAGAGAGGGA
TGAGAGGGAGGGAGAGGAGAGAGAGTGCGAGACCGAGCGAGAAAGCTGGAGAGGAGCAGA
AAGAAACTGCCAGTGGCGGCTAGATTTCGGAGGCCCCAGTGCACCCGTGGACTCCTTCGG
AACTTGGCACCCTCAGGAGCCCTGCAGTCCTCTCAGGCCCGGCTTTCGGGCGCTTGCCGT
GCAGCCGGAGGCTCGGCTCGCTGGAAATCGCCCCGGGAAGCAGTGGGACGCGGAGACAGC
AGCTCTCTCCCGGTAGCCGAATCACTAAATCTGGAGCCGCCAAACTGCTACTTCTGGGCC
CACGGGCCCACAAGGATCGAATCGGCAGAGTCCCCGCCCGCGTTCTCGCTAGCGGGTGGG
GGAACCGCCTGGCCGTCCCCACCCTGGATCCCCACGCCACAGCGCCGGGCAGCCCCTCCT
GTAGGCAGCGACCTTGGCCAGAGGCTCCCCAGGGCCCAGCTCCCTTCAGGAGAGGCCGAG
ACGCAGGGAAACGATAACGGGGAATGGAGACCAACTGCCGCAAACTGGTGTCGGCGTGTG
TGCAATTAGGCGTGCAGCCGGCGGCCGTTGAATGTCTCTTCTCCAAAGACTCCGAAATCA
AAAAGGTCGAGTTCACGGACTCTCCTGAGAGCCGAAAAGAGGCAGCCAGCAGCAAGTTCT
TCCCGCGGCAGCATCCTGGCGCCAATGAGAAAGATAAAAGCCAGCAGGGGAAGAATGAGG
ACGTGGGCGCCGAGGACCCGTCTAAGAAGAAGCGGCAAAGGCGGCAGCGGACTCACTTTA
CCAGCCAGCAGCTCCAGGAGCTGGAGGCCACTTTCCAGAGGAACCGCTACCCGGACATGT
CCACACGCGAAGAAATCGCTGTGTGGACCAACCTTACGGAAGCCCGAGTCCGGGTTTGGT
TCAAGAATCGTCGGGCCAAATGGAGAAAGAGGGAGCGCAACCAGCAGGCCGAGCTATGCA
AGAATGGCTTCGGGCCGCAGTTCAATGGGCTCATGCAGCCCTACGACGACATGTACCCAG
GCTATTCCTACAACAACTGGGCCGCCAAGGGCCTTACATCCGCCTCCCTATCCACCAAGA
GCTTCCCCTTCTTCAACTCTATGAACGTCAACCCCCTGTCATCACAGAGCATGTTTTCCC
CACCCAACTCTATCTCGTCCATGAGCATGTCGTCCAGCATGGTGCCCTCAGCAGTGACAG
GCGTCCCGGGCTCCAGTCTCAACAGCCTGAATAACTTGAACAACCTGAGTAGCCCGTCGC
TGAATTCCGCGGTGCCGACGCCTGCCTGTCCTTACGCGCCGCCGACTCCTCCGTATGTTT
ATAGGGACACGTGTAACTCGAGCCTGGCCAGCCTGAGACTGAAAGCAAAGCAGCACTCCA
GCTTCGGCTACGCCAGCGTGCAGAACCCGGCCTCCAACCTGAGTGCTTGCCAGTATGCAG
TGGACCGGCCCGTGTGAGCCGCACCCACAGCGCCGGGATCCTAGGACCTTGCCGGATGGG
GCAACTCCGCCCTTGAAAGACTGGGAATTATGCTAGAAGGTCGTGGGCACTAAAGAAAGG
GAGAGAAAGAGAAGCTATATAGAGAAAAGGAAACCACTGAATCAAAGAGAGAGCTCCTTT
GATTTCAAAGGGATGTCCTCAGTGTCTGACATCTTTCACTACAAGTATTTCTAACAGTTG
CAAGGACACATACACAAACAAATGTTTGACTGGATATGACATTTTAACATTACTATAAGC
TTGTTATTTTTTAAGTTTAGCATTGTTAACATTTAAATGACTGAAAGGATGTATATATAT
CGAAATGTCAAATTAATTTTATAAAAGCAGTTGTTAGTAATATCACAACAGTGTTTTTAA
AGGTTAGGCTTTAAAATAAAGCATGTTATACAGAAGCGATTAGGATTTTTCGCTTGCGAG
CAAGGGAGTGTATATACTAAATGCCACACTGTATGTTTCTAACATATTATTATTATTATA
AAAAATGTGTGAATATCAGTTTTAGAATAGTTTCTCTGGTGGATGCAATGATGTTTCTGA
AACTGCTATGTACAACCTACCCTGTGTATAACATTTCGTACAATATTATTGTTTTACTTT
TCAGCAAATATGAAACAAATGTGTTTTATTTCATGGGAGTAAAATATACTGCATACAAAA
AA

Protein Sequence

>5308 : length: 324
MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTIS
DTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMS
TREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPG
YSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTG
VPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSS
FGYASVQNPASNLSACQYAVDRPV