ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5292

Name

PIM1

Synonym

PIM;Pim-1 proto-oncogene, serine/threonine kinase;PIM1;Pim-1 proto-oncogene, serine/threonine kinase

Definition

Oncogene PIM1|pim-1 kinase 44 kDa isoform|pim-1 oncogene (proviral integration site 1)|proto-oncogene serine/threonine-protein kinase pim-1|serine/threonine-protein kinase pim-1

Position

6p21.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

Role of Calcineurin-dependent NFAT signaling in lymphocytes;PID Curated;200076

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

GMCSF-mediated signaling events;PID Curated;200015

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

External Links

Links to cell senescence gene database

5292

Links to epithelial mesenchymal transition gene database

5292

Links to ovarian cancer gene database

5292

Links to endometrial cancer gene database

5292

Links to iHOP

5292

Sequence Information

Nucleotide Sequence

>5292 : length: 2751
CCCTTTACTCCTGGCTGCGGGGCGAGCCGGGCGTCTGCTGCAGCGGCCGCGGTGGCTGAG
GAGGCCCGAGAGGAGTCGGTGGCAGCGGCGGCGGCGGGACCGGCAGCAGCAGCAGCAGCA
GCAGCAGCAGCAACCACTAGCCTCCTGCCCCGCGGCGCTGCCGCACGAGCCCCACGAGCC
GCTCACCCCGCCGTTCTCAGCGCTGCCCGACCCCGCTGGCGCGCCCTCCCGCCGCCAGTC
CCGGCAGCGCCCTCAGTTGTCCTCCGACTCGCCCTCGGCCTTCCGCGCCAGCCGCAGCCA
CAGCCGCAACGCCACCCGCAGCCACAGCCACAGCCACAGCCCCAGGCATAGCCTTCGGCA
CAGCCCCGGCTCCGGCTCCTGCGGCAGCTCCTCTGGGCACCGTCCCTGCGCCGACATCCT
GGAGGTTGGGATGCTCTTGTCCAAAATCAACTCGCTTGCCCACCTGCGCGCCGCGCCCTG
CAACGACCTGCACGCCACCAAGCTGGCGCCCGGCAAGGAGAAGGAGCCCCTGGAGTCGCA
GTACCAGGTGGGCCCGCTACTGGGCAGCGGCGGCTTCGGCTCGGTCTACTCAGGCATCCG
CGTCTCCGACAACTTGCCGGTGGCCATCAAACACGTGGAGAAGGACCGGATTTCCGACTG
GGGAGAGCTGCCTAATGGCACTCGAGTGCCCATGGAAGTGGTCCTGCTGAAGAAGGTGAG
CTCGGGTTTCTCCGGCGTCATTAGGCTCCTGGACTGGTTCGAGAGGCCCGACAGTTTCGT
CCTGATCCTGGAGAGGCCCGAGCCGGTGCAAGATCTCTTCGACTTCATCACGGAAAGGGG
AGCCCTGCAAGAGGAGCTGGCCCGCAGCTTCTTCTGGCAGGTGCTGGAGGCCGTGCGGCA
CTGCCACAACTGCGGGGTGCTCCACCGCGACATCAAGGACGAAAACATCCTTATCGACCT
CAATCGCGGCGAGCTCAAGCTCATCGACTTCGGGTCGGGGGCGCTGCTCAAGGACACCGT
CTACACGGACTTCGATGGGACCCGAGTGTATAGCCCTCCAGAGTGGATCCGCTACCATCG
CTACCATGGCAGGTCGGCGGCAGTCTGGTCCCTGGGGATCCTGCTGTATGATATGGTGTG
TGGAGATATTCCTTTCGAGCATGACGAAGAGATCATCAGGGGCCAGGTTTTCTTCAGGCA
GAGGGTCTCTTCAGAATGTCAGCATCTCATTAGATGGTGCTTGGCCCTGAGACCATCAGA
TAGGCCAACCTTCGAAGAAATCCAGAACCATCCATGGATGCAAGATGTTCTCCTGCCCCA
GGAAACTGCTGAGATCCACCTCCACAGCCTGTCGCCGGGGCCCAGCAAATAGCAGCCTTT
CTGGCAGGTCCTCCCCTCTCTTGTCAGATGCCCGAGGGAGGGGAAGCTTCTGTCTCCAGC
TTCCCGAGTACCAGTGACACGTCTCGCCAAGCAGGACAGTGCTTGATACAGGAACAACAT
TTACAACTCATTCCAGATCCCAGGCCCCTGGAGGCTGCCTCCCAACAGTGGGGAAGAGTG
ACTCTCCAGGGGTCCTAGGCCTCAACTCCTCCCATAGATACTCTCTTCTTCTCATAGGTG
TCCAGCATTGCTGGACTCTGAAATATCCCGGGGGTGGGGGGTGGGGGTGGGTCAGAACCC
TGCCATGGAACTGTTTCCTTCATCATGAGTTCTGCTGAATGCCGCGATGGGTCAGGTAGG
GGGGAAACAGGTTGGGATGGGATAGGACTAGCACCATTTTAAGTCCCTGTCACCTCTTCC
GACTCTTTCTGAGTGCCTTCTGTGGGGACTCCGGCTGTGCTGGGAGAAATACTTGAACTT
GCCTCTTTTACCTGCTGCTTCTCCAAAAATCTGCCTGGGTTTTGTTCCCTATTTTTCTCT
CCTGTCCTCCCTCACCCCCTCCTTCATATGAAAGGTGCCATGGAAGAGGCTACAGGGCCA
AACGCTGAGCCACCTGCCCTTTTTTCTGCCTCCTTTAGTAAAACTCCGAGTGAACTGGTC
TTCCTTTTTGGTTTTTACTTAACTGTTTCAAAGCCAAGACCTCACACACACAAAAAATGC
ACAAACAATGCAATCAACAGAAAAGCTGTAAATGTGTGTACAGTTGGCATGGTAGTATAC
AAAAAGATTGTAGTGGATCTAATTTTTAAGAAATTTTGCCTTTAAGTTATTTTACCTGTT
TTTGTTTCTTGTTTTGAAAGATGCGCATTCTAACCTGGAGGTCAATGTTATGTATTTATT
TATTTATTTATTTGGTTCCCTTCCTATTCCAAGCTTCCATAGCTGCTGCCCTAGTTTTCT
TTCCTCCTTTCCTCCTCTGACTTGGGGACCTTTTGGGGGAGGGCTGCGACGCTTGCTCTG
TTTGTGGGGTGACGGGACTCAGGCGGGACAGTGCTGCAGCTCCCTGGCTTCTGTGGGGCC
CCTCACCTACTTACCCAGGTGGGTCCCGGCTCTGTGGGTGATGGGGAGGGGCATTGCTGA
CTGTGTATATAGGATAATTATGAAAAGCAGTTCTGGATGGTGTGCCTTCCAGATCCTCTC
TGGGGCTGTGTTTTGAGCAGCAGGTAGCCTGCTGGTTTTATCTGAGTGAAATACTGTACA
GGGGAATAAAAGAGATCTTATTTTTTTTTTTATACTTGGCGTTTTTTGAATAAAAACCTT
TTGTCTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>5292 : length: 404
MPHEPHEPLTPPFSALPDPAGAPSRRQSRQRPQLSSDSPSAFRASRSHSRNATRSHSHSH
SPRHSLRHSPGSGSCGSSSGHRPCADILEVGMLLSKINSLAHLRAAPCNDLHATKLAPGK
EKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPME
VVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFW
QVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSP
PEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRW
CLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK