ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5290

Name

PIK3CA

Synonym

CLOVE|CWS5|MCAP|MCM|MCMTC|PI3K|p110-alpha;phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit alpha;PIK3CA;phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit alpha

Definition

PI3-kinase p110 subunit alpha|PI3K-alpha|phosphatidylinositol 3-kinase, catalytic, 110-KD, alpha|phosphatidylinositol 3-kinase, catalytic, alpha polypeptide|phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform|phosphatidylinosito

Position

3q26.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

il-2 receptor beta chain in t cell activation;PID BioCarta;100129

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

Axon guidance mediated by netrin;PANTHER;P00009

Pathway

Phosphatidylinositol signaling system;KEGG PATHWAY;hsa04070

Pathway

role of erbb2 in signal transduction and oncology;PID BioCarta;100147

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

role of pi3k subunit p85 in regulation of actin organization and cell migration;PID BioCarta;100211

Pathway

phospholipase c signaling pathway;PID BioCarta;100069

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

insulin signaling pathway;PID BioCarta;100124

Pathway

mtor signaling pathway;PID BioCarta;100101

Pathway

pdgf signaling pathway;PID BioCarta;100077

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

pten dependent cell cycle arrest and apoptosis;PID BioCarta;100058

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

egf signaling pathway;PID BioCarta;100181

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Aldosterone-regulated sodium reabsorption;KEGG PATHWAY;hsa04960

Pathway

inhibition of cellular proliferation by gleevec;PID BioCarta;100154

Pathway

EPHA2 forward signaling;PID Curated;200185

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

Inositol phosphate metabolism;KEGG PATHWAY;hsa00562

Pathway

the igf-1 receptor and longevity;PID BioCarta;100115

Pathway

IL1-mediated signaling events;PID Curated;200075

Pathway

nfat and hypertrophy of the heart ;PID BioCarta;100098

Pathway

b cell survival pathway;PID BioCarta;100228

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

tpo signaling pathway;PID BioCarta;100012

Pathway

regulation of bad phosphorylation;PID BioCarta;100233

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

trka receptor signaling pathway;PID BioCarta;100011

Pathway

Atypical NF-kappaB pathway;PID Curated;200017

Pathway

multiple antiapoptotic pathways from igf-1r signaling lead to bad phosphorylation;PID BioCarta;100135

Pathway

VEGFR1 specific signals;PID Curated;200151

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

BCR signaling pathway;PID Curated;200005

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

human cytomegalovirus and map kinase pathways;PID BioCarta;100149

Pathway

3-phosphoinositide biosynthesis;BioCyc;PWY-6352

Pathway

growth hormone signaling pathway;PID BioCarta;100155

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

nerve growth factor pathway (ngf);PID BioCarta;100096

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

p53 pathway;PANTHER;P00059

Pathway

B cell activation;PANTHER;P00010

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Insulin/IGF pathway-protein kinase B signaling cascade;PANTHER;P00033

Pathway

Angiogenesis;PANTHER;P00005

Pathway

phospholipids as signalling intermediaries;PID BioCarta;100183

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

transcription factor creb and its extracellular signals;PID BioCarta;100198

Pathway

inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

Gab1 signalosome;PID Reactome;500514

Pathway

role of nicotinic acetylcholine receptors in the regulation of apoptosis;PID BioCarta;100255

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

ras-independent pathway in nk cell-mediated cytotoxicity;PID BioCarta;100095

Pathway

thrombin signaling and protease-activated receptors;PID BioCarta;100082

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

E-cadherin signaling in keratinocytes;PID Curated;200125

Pathway

trefoil factors initiate mucosal healing;PID BioCarta;100018

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

Trk receptor signaling mediated by PI3K and PLC-gamma;PID Curated;200183

Pathway

skeletal muscle hypertrophy is regulated via akt-mtor pathway;PID BioCarta;100137

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

Nongenotropic Androgen signaling;PID Curated;200145

Pathway

corticosteroids and cardioprotection;PID BioCarta;100156

Pathway

tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237

Pathway

Signaling by EGFR;Reactome;REACT:9417

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

fc epsilon receptor i signaling in mast cells;PID BioCarta;100165

Pathway

bioactive peptide induced signaling pathway;PID BioCarta;100226

Pathway

S1P2 pathway;PID Curated;200181

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

mTOR signaling pathway;KEGG PATHWAY;hsa04150

Pathway

ras signaling pathway;PID BioCarta;100047

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

actions of nitric oxide in the heart;PID BioCarta;100094

Pathway

the co-stimulatory signal during t-cell activation;PID BioCarta;100193

Pathway

cxcr4 signaling pathway;PID BioCarta;100192

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

Interactions of the immunoglobulin superfamily (IgSF) member proteins;Reactome;REACT:23853

Pathway

Hemostasis;Reactome;REACT:604

Pathway

erk and pi-3 kinase are necessary for collagen binding in corneal epithelia;PID BioCarta;100184

Pathway

IL23-mediated signaling events;PID Curated;200131

Pathway

il-7 signal transduction;PID BioCarta;100125

Pathway

vegf hypoxia and angiogenesis;PID BioCarta;100006

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

GMCSF-mediated signaling events;PID Curated;200015

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

igf-1 signaling pathway;PID BioCarta;100136

Pathway

Fc-epsilon receptor I signaling in mast cells;PID Curated;200003

Pathway

akt signaling pathway;PID BioCarta;100245

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Endothelin signaling pathway;PANTHER;P00019

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

T cell activation;PANTHER;P00053

Pathway

Reelin signaling pathway;PID Curated;200051

Pathway

Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128

Pathway

Carbohydrate digestion and absorption;KEGG PATHWAY;hsa04973

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

role of erk5 in neuronal survival pathway;PID BioCarta;100171

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

PI3 kinase pathway;PANTHER;P00048

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

ctcf: first multivalent nuclear factor;PID BioCarta;100194

Pathway

IL2 signaling events mediated by STAT5;PID Curated;200158

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

Hypoxia response via HIF activation;PANTHER;P00030

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

rac1 cell motility signaling pathway;PID BioCarta;100056

Pathway

t cell receptor signaling pathway;PID BioCarta;100022

Pathway

control of skeletal myogenesis by hdac and calcium/calmodulin-dependent kinase (camk);PID BioCarta;100148

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Signaling by FGFR;Reactome;REACT:9470

Pathway

Type II diabetes mellitus;KEGG PATHWAY;hsa04930

Pathway

Ras Pathway;PANTHER;P04393

Pathway

regulation of eif-4e and p70s6 kinase;PID BioCarta;100178

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Keratosis, seborrheic, somatic;OMIM

Disease

Cancers;KEGG DISEASE

Disease

Nonsmall cell lung cancer, somatic;OMIM

Disease

Ovarian cancer, somatic;OMIM

Disease

breast cancer;GAD

Disease

Colonic Neoplasms;GAD

Disease

Colorectal cancer, somatic;OMIM

Disease

Nevus, epidermal;OMIM

Disease

CANCER;GAD

Disease

Gastric cancer, somatic;OMIM

Disease

Ovarian cancer;KEGG DISEASE;H00027

Disease

Breast cancer, somatic;OMIM

Disease

Cancers of the breast and female genital organs;KEGG DISEASE

Disease

Hepatocellular carcinoma, somatic;OMIM

Disease

colorectal cancer;GAD

External Links

Links to cell senescence gene database

5290

Links to epithelial mesenchymal transition gene database

5290

Links to ovarian cancer gene database

5290

Links to endometrial cancer gene database

5290

Links to iHOP

5290

Sequence Information

Nucleotide Sequence

>5290 : length: 9109
TTCCGGGGGATTGTAGGCTCTGCCCCTCCTCAGCTCTTACCCTCTTCTGCCGGAGGAGGG
GGGGGGCCGAGGGGGTGGGGAAGAGTTCGTTGTTTGTTTACACGATGTTTCTGCTTTGGG
ACAACCATACATCTAATTCCTTAAAGTAGTTTTATATGTAAAACTTGCAAAGAATCAGAA
CAATGCCTCCACGACCATCATCAGGTGAACTGTGGGGCATCCACTTGATGCCCCCAAGAA
TCCTAGTAGAATGTTTACTACCAAATGGAATGATAGTGACTTTAGAATGCCTCCGTGAGG
CTACATTAATAACCATAAAGCATGAACTATTTAAAGAAGCAAGAAAATACCCCCTCCATC
AACTTCTTCAAGATGAATCTTCTTACATTTTCGTAAGTGTTACTCAAGAAGCAGAAAGGG
AAGAATTTTTTGATGAAACAAGACGACTTTGTGACCTTCGGCTTTTTCAACCCTTTTTAA
AAGTAATTGAACCAGTAGGCAACCGTGAAGAAAAGATCCTCAATCGAGAAATTGGTTTTG
CTATCGGCATGCCAGTGTGTGAATTTGATATGGTTAAAGATCCAGAAGTACAGGACTTCC
GAAGAAATATTCTGAACGTTTGTAAAGAAGCTGTGGATCTTAGGGACCTCAATTCACCTC
ATAGTAGAGCAATGTATGTCTATCCTCCAAATGTAGAATCTTCACCAGAATTGCCAAAGC
ACATATATAATAAATTAGATAAAGGGCAAATAATAGTGGTGATCTGGGTAATAGTTTCTC
CAAATAATGACAAGCAGAAGTATACTCTGAAAATCAACCATGACTGTGTACCAGAACAAG
TAATTGCTGAAGCAATCAGGAAAAAAACTCGAAGTATGTTGCTATCCTCTGAACAACTAA
AACTCTGTGTTTTAGAATATCAGGGCAAGTATATTTTAAAAGTGTGTGGATGTGATGAAT
ACTTCCTAGAAAAATATCCTCTGAGTCAGTATAAGTATATAAGAAGCTGTATAATGCTTG
GGAGGATGCCCAATTTGATGTTGATGGCTAAAGAAAGCCTTTATTCTCAACTGCCAATGG
ACTGTTTTACAATGCCATCTTATTCCAGACGCATTTCCACAGCTACACCATATATGAATG
GAGAAACATCTACAAAATCCCTTTGGGTTATAAATAGTGCACTCAGAATAAAAATTCTTT
GTGCAACCTACGTGAATGTAAATATTCGAGACATTGATAAGATCTATGTTCGAACAGGTA
TCTACCATGGAGGAGAACCCTTATGTGACAATGTGAACACTCAAAGAGTACCTTGTTCCA
ATCCCAGGTGGAATGAATGGCTGAATTATGATATATACATTCCTGATCTTCCTCGTGCTG
CTCGACTTTGCCTTTCCATTTGCTCTGTTAAAGGCCGAAAGGGTGCTAAAGAGGAACACT
GTCCATTGGCATGGGGAAATATAAACTTGTTTGATTACACAGACACTCTAGTATCTGGAA
AAATGGCTTTGAATCTTTGGCCAGTACCTCATGGATTAGAAGATTTGCTGAACCCTATTG
GTGTTACTGGATCAAATCCAAATAAAGAAACTCCATGCTTAGAGTTGGAGTTTGACTGGT
TCAGCAGTGTGGTAAAGTTCCCAGATATGTCAGTGATTGAAGAGCATGCCAATTGGTCTG
TATCCCGAGAAGCAGGATTTAGCTATTCCCACGCAGGACTGAGTAACAGACTAGCTAGAG
ACAATGAATTAAGGGAAAATGACAAAGAACAGCTCAAAGCAATTTCTACACGAGATCCTC
TCTCTGAAATCACTGAGCAGGAGAAAGATTTTCTATGGAGTCACAGACACTATTGTGTAA
CTATCCCCGAAATTCTACCCAAATTGCTTCTGTCTGTTAAATGGAATTCTAGAGATGAAG
TAGCCCAGATGTATTGCTTGGTAAAAGATTGGCCTCCAATCAAACCTGAACAGGCTATGG
AACTTCTGGACTGTAATTACCCAGATCCTATGGTTCGAGGTTTTGCTGTTCGGTGCTTGG
AAAAATATTTAACAGATGACAAACTTTCTCAGTATTTAATTCAGCTAGTACAGGTCCTAA
AATATGAACAATATTTGGATAACTTGCTTGTGAGATTTTTACTGAAGAAAGCATTGACTA
ATCAAAGGATTGGGCACTTTTTCTTTTGGCATTTAAAATCTGAGATGCACAATAAAACAG
TTAGCCAGAGGTTTGGCCTGCTTTTGGAGTCCTATTGTCGTGCATGTGGGATGTATTTGA
AGCACCTGAATAGGCAAGTCGAGGCAATGGAAAAGCTCATTAACTTAACTGACATTCTCA
AACAGGAGAAGAAGGATGAAACACAAAAGGTACAGATGAAGTTTTTAGTTGAGCAAATGA
GGCGACCAGATTTCATGGATGCTCTACAGGGCTTTCTGTCTCCTCTAAACCCTGCTCATC
AACTAGGAAACCTCAGGCTTGAAGAGTGTCGAATTATGTCCTCTGCAAAAAGGCCACTGT
GGTTGAATTGGGAGAACCCAGACATCATGTCAGAGTTACTGTTTCAGAACAATGAGATCA
TCTTTAAAAATGGGGATGATTTACGGCAAGATATGCTAACACTTCAAATTATTCGTATTA
TGGAAAATATCTGGCAAAATCAAGGTCTTGATCTTCGAATGTTACCTTATGGTTGTCTGT
CAATCGGTGACTGTGTGGGACTTATTGAGGTGGTGCGAAATTCTCACACTATTATGCAAA
TTCAGTGCAAAGGCGGCTTGAAAGGTGCACTGCAGTTCAACAGCCACACACTACATCAGT
GGCTCAAAGACAAGAACAAAGGAGAAATATATGATGCAGCCATTGACCTGTTTACACGTT
CATGTGCTGGATACTGTGTAGCTACCTTCATTTTGGGAATTGGAGATCGTCACAATAGTA
ACATCATGGTGAAAGACGATGGACAACTGTTTCATATAGATTTTGGACACTTTTTGGATC
ACAAGAAGAAAAAATTTGGTTATAAACGAGAACGTGTGCCATTTGTTTTGACACAGGATT
TCTTAATAGTGATTAGTAAAGGAGCCCAAGAATGCACAAAGACAAGAGAATTTGAGAGGT
TTCAGGAGATGTGTTACAAGGCTTATCTAGCTATTCGACAGCATGCCAATCTCTTCATAA
ATCTTTTCTCAATGATGCTTGGCTCTGGAATGCCAGAACTACAATCTTTTGATGACATTG
CATACATTCGAAAGACCCTAGCCTTAGATAAAACTGAGCAAGAGGCTTTGGAGTATTTCA
TGAAACAAATGAATGATGCACATCATGGTGGCTGGACAACAAAAATGGATTGGATCTTCC
ACACAATTAAACAGCATGCATTGAACTGAAAAGATAACTGAGAAAATGAAAGCTCACTCT
GGATTCCACACTGCACTGTTAATAACTCTCAGCAGGCAAAGACCGATTGCATAGGAATTG
CACAATCCATGAACAGCATTAGAATTTACAGCAAGAACAGAAATAAAATACTATATAATT
TAAATAATGTAAACGCAAACAGGGTTTGATAGCACTTAAACTAGTTCATTTCAAAATTAA
GCTTTAGAATAATGCGCAATTTCATGTTATGCCTTAAGTCCAAAAAGGTAAACTTTGAAG
ATTGTTTGTATCTTTTTTTAAAAAACAAAACAAAACAAAAATCCCCAAAATATATAGAAA
TGATGGAGAAGGAAAAAGTGATGGTTTTTTTTGTCTTGCAAATGTTCTATGTTTTGAAAT
GTGGACACAACAAAGGCTGTTATTGCATTAGGTGTAAGTAAACTGGAGTTTATGTTAAAT
TACATTGATTGGAAAAGAATGAAAATTTCTTATTTTTCCATTGCTGTTCAATTTATAGTT
TGAAGTGGGTTTTTGACTGCTTGTTTAATGAAGAAAAATGCTTGGGGTGGAAGGGACTCT
TGAGATTTCACCAGAGACTTTTTCTTTTTAATAAATCAAACCTTTTGATGATTTGAGGTT
TTATCTGCAGTTTTGGAAGCAGTCACAAATGAGACCTGTTATAAGGTGGTATTTTTTTTT
TTCTTCTGGACAGTATTTAAAGGATCTTATTCTTATTTCCCAGGGAAATTCTGGGCTCCC
ACAAAGTAAAAAAAAAAAAAAATCATAGAAAAAGAATGAGCAGGAATAGTTCTTATTCCA
GAATTGTACAGTATTCACCTTAAGTTGATTTTTTTTCTCCTTCTGCAATTGAACTGAATA
CATTTTTCATGCATGTTTTCCAGAAAATAGAAGTATTAATGTTATTAAAAAGATTATTTT
TTTTATTAAAGGCTATTTATATTATAGAAACTATCATTAATATATATTCTTTATTTACAT
GATCTGTCCCATAGTCATGCATTGTTTTGCACCCCAAATTTTTTATTGTTCATAGCAGCA
TGGTCAGCTTTCTTCTTGATCTATAGATGAGGCTCAGGCACTATCCCATTTATACCAATA
ACCAGTGTATAACTACTTAAGGAAAACATAAAAACTTCATCTTCTTTCCTTTTATTTCTT
ATGTGAATCTCCCGTCTTCCATTCTCTTTTATAATTGAGAATGTCTCAATCATATGAAAT
TAGTTACCAGAATTAACACAATTTAGACTATCTTCCTGATTCCTTAAACCCCTTTACTGA
AGTATACTCATGAATAATACTTTAAAATATGGGGGAATAGAAACCATGAACTTTTTACCT
TTTTAAACTATTTATCCATATCTCCAAAGTAGAACATTAAACCATTTTAAGATATGTCTC
ATTCCCAAGTAGTCAGAGCTCACTCTCCAACTTTATTAAATACTATTTGAGCACAGGACA
CATTCTTAAACATTTTGAAAAACATTAACCCAAGATGTAGAGGCTACTGCTAGTCGTCAT
TCTAGAATCTGATATTTTACTCTGTATTTGAAATGAATGATTAATGTCCTAGGAAATTAG
CTTTAGCAGATGTCCAGGTGCCACATCAAAAAAGTGCAATAATTATTGACAGTTTTTTAG
ATTAGGCATATTATTGGAAAACAACTTTATAAAGAGTGAACATTGTATACTCTAGTAAAA
CAGCATCACTTTAAAAATATTCATTTATGAAATCTGTTACCTATAGTTGAAGTCTTGAGT
AGTGAACAAGGGACTCTAATACCAATACTCTTAATATCTGGCTATTTTAGATCCCTTAAA
GGGCATAATTATTGGAAATTTAGGTATTTCACTAAAGCATGTATATAATATTGCCAACAA
GAAAAGTAAATTTGAAGATTAAGGGAACTTACTTCTGCAAACTGTCTTGCGATAGTTAAG
CAGAATTTAAACTCTGTTTTAAGCAGGAAACCAGAAAGATTATTTTGCAGTTGTAGAAGA
TTTCATAACTTATTAAAACTTATTAACATTTTGTGTTGTTTAGATATAGGCAGTTGATAC
ATACTAACATCCCAGCCTTTTCAATATCAGGGTTAAATTATAGGAAAACTCAGTAAAATG
GTACAAATCTGAAAGTTTGATGGTAGAAACTGAAGATTTAACAGAGAACTGTGTTTTACC
CGAGTGCCAAAAATGCTGTGAGCCTCCTTGCACAAAATTTATACCACTTTTGCATTTTTA
TCTATCAGTCCAGATAGTTGTCTCCCCTCCTTCTCCCAGGACCTCTCCACCATTAAAATG
CACAAACCACATGGCCGATTTCACCATTTACATTTATTTTCAAAAGTTACTACAACCAAA
TTAATTCTATTAGAAGAAATGTAGACAAATTCTATAAAGACTATAGATTGTGACCTAAGA
AAGAAATGAGGCAAAGAACCAAACATTGAATTAAATGCTACATGGGTGACTAAGATCTGT
TTCAAGTCAGTGATAATATAGCCACTTCTGGGTACTTCAGTATCAGAGATCAGTTCTCGT
GGTTTAGACAGTTCCTATCTATAGCTGACTATCCTTGTCCTTGAATATGGTGTAACTGAC
TATTGGCTCTACAGTTTTATTGGGCCACTTAAGAAATATTTCCTTGAATAATTATTTTGA
GAAAAAGTCTAAAAGTAATAAAAATAATTTTAAACACACTGTAGTAAGAAATGACTGTTG
GAAAATTATGCTTTCACTTTCTACCATATTCTCAGCTATACAAAACCATTTATTTTGAAG
ATTTTTAGACTACTGTTAATTTGAAATCTGTTACTCTTATTGTGGAATTTGTTTTTTTAA
AAAAGATGTTTCTAATTGGATTTTTAAAAGAAGAATGGAATTTGGTTGCTATTTTACAAT
AGAACCTAAGCTTTTTGTGGTTCTTAGTGTCCTATGTAAAACTTAGTGTCAAAGTAATCA
ACTTTGAGATTTTCCCTTCTATTCTGCTTTATATTAAAAGCCCATTAGAAAATGGGAACC
TGGTGAATATATAATGAATTGTAAAATATTTTAATGTGTAACTTTTTCAACTGTGAAACT
GACTTGATTTTTTGATGAAAACAGCTGCTGATAAAGTATTTTGTGTAAAGTGTAGTTCTT
ATTAATCAGGAAAATGATGACTTGATTAGACTGTATATGCCCTCTTGGATTTTATTTTAA
ATGGATTGGTGACTTTCACATAGGTAAAACACAGTCCATCTGTATTCTTTTTTCCATCAA
AAATCGAGTGATTTGGAATTATAAAAAAATTGTGAGCAGCCTATTTGAAAGGCATCATGG
AAATTTCACAGCACAATAACACGGATTTGTTTTTTCTTAATGATGTAAATCCGTTTAATT
CATACTTTGATCAATAGCCCATGCTTGCCAACTCTGAAGAAATTTAATTTCCAGCAGTAT
TTTAAAGCTAGCCTGTTAACTTTTTCTGAATATTTAAAGTTCCTCTTTTTTCTATGTCTG
CACAAACTGCAGACCTGGGCTGGACCCACATACTCAAGAGTCCACCTTAAGAAATTATTT
TGATGTCCAAGACATCACTAAAATATTTAAGTTTAAAGATAATATGTGGTGTTAATAGAT
TGTGGTGCTTTTACTATTTAAAGACAACTTTCATACTTCAGATGTTTTTGAGAAGAGGGG
AATGTGAGGGGAGGGGGCAGAACAGGGAGGAGTTGTTTGAATGAATTACATTCTTTATAT
CCATCCTGCTCATTTGGGGCATGTCTTTAAGAGAAGGCTGAAAGTTGTGAGAGTATATTG
TATACCGTAAGAGAATCAACTCTTCATCATGGATGGGATTGTGAAGGCTGAACTATAAAA
TTCAGCATTGACAGCATCCTCAATTAATAATTCTTGGTGACAGAATAATACAGCTGGGCT
GTTTTTTAAAATATAAACAATACCATTTTTAATTATTACATTAAAAATTGTAAATATATC
TATGTGCCATGGCCTGGGAAGCCTGCTTTCTTTTTTCATAAAAATTATTTTTACTGTATG
AAAAGATCATGGGGTTTAGCTCAAAATATCTGTGGTCCTGATAAAATTGGATTGGTAACT
CTACCTCAGAAGGAAAATGGGAAAAAAAAATAGATGAGTCACAATTCAATACTTCAAGCT
CAGAAACTGTGCAGATCACTGAATTTTAGATTTATAAAGTCAGAGTTGGCATGCCTTGTT
TTTAATGATATGGAAGACCTTAAGAAAAAAACTTGGCTGAAGTTTAATCGTTGGTCCAGC
CATTTGAAAAAGGCAATAGTTTGAGGAGGTTCCCGAATTCGGCATTTGAAATTCATTTTG
TTCTCTCTTCTTCATTATTAGTGCATTTGGTGTGTGTATACTTGCACACAATTCTGTTTG
TGTACACACTGCTTGCTTAGCCCTAGTCAAGAGGCATCTTTTATAAAAGGTGTAAAGAAA
TATCAAGGTTCTAAAATTCGGAAGAGTTTAGAATTTATTAGGAGTTTCCCAAGTTGGGAT
GTTAGTCTTTAAATAAACTTCATGCACCTATTCCACTTAAGGTTTTGCACCTCCTTTTTA
TTAGTGCAGTGCCATTTCTTCTGCTTGATTTTAGGTATGTTAATATTCCAGCCTTGCTAG
TTAGCATAAAGTGACAGGTGTGAGCCATGAGGAAATTTTCTGACTTAATTTGTACACAAC
TACATATAAGAGTTTTAGTGGAGGAAAAAAATTAGTCCCTTGTGCGTATACAGTAGTTAG
GTAAATGATTTTTCTACCAACAGTATACTCCATTCCTCATGTAGGTAAGTACAGAAAAGG
TTTTTAAATGTATTTTTTTAGCCAGTTAAAGTCTATGAATCTATCTGCAACCTTATTTAA
TCTGTCACTATAATAATTTTGTGGTTATGCTAAGAACCATGTATACTTTTAGGTATTCTT
ATTTTTGTCAATTTTTCTAGGTTGGCAAGGAGGCAGAAAACCTTCATTGTTTCATATTAA
AATATAATTAGACTAAACTTAATTCTAGTATGAATTTCCAAAATCATTATCTATTTATTT
CATTTTTATTTAATTTTGTTTTTATTTCATTTTTAAAAGTCCCTTGTTCAATTTAACTTA
TGTTCCTAAGAGAGGTTGGAGAACTTGGCCTTCATCTGATTTCAAAAATGTTTTGAGTTT
CAAATGAAGTTAATGGTTTCAGTGTGATTCAGTCCTCAGACCTAATTGGGTTGAATAAAA
TCTAAAAGAATATACCCTTTTGGAGCATAACATTTTAATACCTTGGGGAATGTGGCACTA
CCAAAAGAAGACTACTAACACGTCAGATGTTCACCTGGAAGCTTTATCAAGAAATTCGAA
CCACCCTTTTGGCCCCATTAATTGTAGCAAGTTTATTTCTCTATATTTTGTCATTCAGTG
AATTGAAGTCCTGTGGTATACTGCATTCATTAGAAGAAAAACGTTTTTAATGTCCTTTTA
ATGATGGCCCAGAAAGCATTTGACACAGCAAGATGCATGTGTTACTATATTGAGAATATA
GAATAATAACAGTATCACTAAATTTAAGACCTCTTCCCAGTCTTGCTGTTCCTAGCAAGA
AGTTTGGCCTGTGACTGCACTTACTGTTTATGCTCATCAGAAACTGTCAATGTCTGCTTT
TCTTTAACTCTGCAGTCTGTAACATCACGCTGTTTATTAAAAAAAAAAA

Protein Sequence

>5290 : length: 1068
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN