ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5218

Name

CDK14

Synonym

PFTAIRE1|PFTK1;cyclin-dependent kinase 14;CDK14;cyclin-dependent kinase 14

Definition

PFTAIRE protein kinase 1|cell division protein kinase 14|serine/threonine-protein kinase PFTAIRE-1

Position

7q21-q22

Gene Type

protein-coding

External Links

Links to cell senescence gene database

5218

Links to epithelial mesenchymal transition gene database

5218

Links to ovarian cancer gene database

5218

Links to endometrial cancer gene database

5218

Links to iHOP

5218

Sequence Information

Nucleotide Sequence

>5218 : length: 5164
AGAGACTGACTGGAGGTTACTCATGGGAGAGTCTTTTGAGGCTCCCGAGGCTACTGCTTG
TAGTTTGTAAACACCAGTAGCAGTGATAAGATGGGGAAAAGGTTTAACGACTGCTTCTTT
GCCATATCTGAGTCTTATTCCTTCTGAAACTAGTCTTTATTTATTACAGCTGAAAGAGAT
CTTACATTTTTTTTTGCCTGGCTGTGCTTGGCTGAATGCCCTCTGAGTCAAGCAAGTGAA
GGACGAGAGACTACTTTTTCCATTTGAGTAAACTGATGTCCATGAATTTAGCTGGATTGG
ATCTGAGTAGAATAAATATCTCTAATATATTAGAGACCTGGGGCTTCCTCCCTGCTCATC
CTATTTCCTTCCTTTTTGGATCACAGAAATACACCTGCTTTAAGTGTGTACTGCTGAGCA
GAGATATGTGTCACAAAGATGTCTACACGGAACTGCCAGGGAATGGACTCAGTGATCAAA
CCCCTGGACACAATTCCTGAGGATAAAAAAGTCAGAGTTCAGAGGACACAGAGCACTTTT
GACCCATTTGAGAAACCAGCTAATCAAGTAAAGAGGGTGCATTCTGAGAACAATGCTTGC
ATTAACTTTAAGACCTCCTCCACTGGCAAAGAGTCACCTAAAGTTAGGCGGCACTCCAGC
CCCAGCTCGCCAACAAGTCCCAAATTTGGAAAAGCTGACTCATATGAAAAGCTGGAAAAA
CTAGGGGAAGGATCTTATGCTACAGTATACAAAGGGAAAAGCAAGGTAAATGGGAAGTTG
GTAGCTCTGAAGGTGATCAGGCTGCAGGAAGAAGAAGGGACACCTTTCACAGCTATCAGG
GAAGCTTCTCTTTTAAAAGGACTAAAACATGCTAACATAGTGCTACTTCATGACATCATC
CATACCAAGGAGACGCTGACACTTGTGTTTGAATATGTGCACACTGATTTATGTCAGTAC
ATGGACAAGCACCCTGGGGGGCTGCATCCAGATAATGTGAAGTTGTTTTTATTTCAGTTG
CTGCGAGGTCTGTCTTACATCCACCAGCGTTATATTTTGCACAGAGACCTGAAACCACAG
AACCTTCTGATCAGTGACACGGGGGAGTTAAAGCTGGCAGATTTCGGTCTTGCAAGAGCA
AAATCCGTCCCTAGCCACACATACTCCAACGAAGTGGTTACCTTGTGGTACAGACCTCCA
GATGTCCTTCTAGGCTCAACAGAATATTCCACCTGCCTTGACATGTGGGGAGTAGGTTGC
ATCTTTGTTGAAATGATCCAAGGAGTTGCTGCTTTTCCAGGAATGAAAGACATTCAGGAT
CAACTTGAACGAATATTTCTGGTTCTTGGAACACCAAATGAGGACACATGGCCTGGAGTT
CATTCTTTACCACATTTTAAGCCAGAACGCTTTACCCTGTACAGCTCTAAAAACCTTAGA
CAAGCATGGAATAAGCTCAGCTATGTGAACCATGCAGAGGACCTGGCCTCCAAGCTCCTA
CAATGTTCCCCAAAGAACAGACTGTCGGCACAGGCTGCCTTGAGCCACGAGTATTTTAGT
GACCTGCCGCCACGGCTATGGGAACTCACCGACATGTCTTCTATTTTTACTGTCCCAAAT
GTGAGATTGCAACCAGAAGCTGGAGAAAGCATGCGGGCCTTTGGGAAAAACAATAGTTAT
GGCAAAAGTCTATCAAACAGCAAGCACTGACAAGCAGCACATTCTCAAGAGCACACAGGA
TTAAGTTGTCATCATTCTGGGAAGAAAAAAAAAACATTAATGAAGAGGCCAATAATATGA
AGGGAATCATGGATCAGTTTTCTTTCGCTCCCTGTGGTGGATTTCACTTACAAGAAAATT
GAAGCTGGCAAGACCCTGTTTTCTCTGCAATTTATTTAAAACCTTGCACGCATTTGGATA
CCTTGTGATTTCCAAGAACTACGTGAAGATTAAGCTTTGCTTACTGATACATGGCATGTA
TTCTTTTCAGTCTTTTGTGTTTGATTTTGTTTGATTTCCCTCTGCAGCACAGCGTCTCTG
TAAAGGTTTTTATGCTTTCACCAGCCATGTCTTAAATACATTAAGACAACACATTTGGTG
TTCACACTTCTTCAGTAATGTCTGAACTTGAAAGCCACAGAGTGGCATAAAACAATGTGT
GTTTTCTTTGAGAGCAGTGCACATTTTGCAACCACTAGGAAGGAAATTTTCTGCTAAAGC
AAACCCCTGTTCTCTGACTTGACAACTTGGCCCCGGACTGTGGGGCCCCACCTGTTGCTT
ACCTTTTGAGGTAATTTTGCAAATGTGGTTTTTTTACTTGGAAATAACTGCACATTTATA
TATAGGATATTGGACTCTGCTTAGCATTTTCAAGCCACATAGCATGACTGTTTTTTGAAT
AGGTTGGAATTGAAAAAACAATTATCAAACGTTAAGAACAAAGACAGGGATAAATTGCTT
ACATTTCAACCTCTGGAGATTGAGGTAACTTTTTGTGTCTGGGTCTTGTCAACATCTAAT
TTTTTTCCATCCATTCTGTTACACTTTGTATTTTCTAACTGGAGAAAAGAGTGAGGAACA
GAATGTTTTAAATCTGGTGCAAAAGAACTATATCTGCTGGATGAGCCTTGAAAGCAGTCT
TGGCCTGTTAGGGCTTACAAAGTAAATTACAAAGTGATCCAGTTCAAAGTTTGCTTAGTT
ACAACAAAGCACCTTTAAAAAAAATACATTTTAAAAAAACATTCCAAGCCAATTGGAAGA
CATCATTGGGTTCTTACTTTAAGACATCTCCTGGAATAACTGTTCAAATGCAGGTTTTAG
AAACAATGCAGGAATCTTGCTTTAAAGATGAAAAAGGGAATGGGCCAGCTTCCCTTACTC
AAGGAGTTGAGGGACCTTGGAGGATGAAGGCGAGTATGTGACACTGGAGAAAAGTGGACC
AGGCATGTCTTTTGCTTTGATCTGGAGGGAGGGCTGCCTGATGCAGGCCGGCTCCCAGTG
GGGCAGGCCTCGCTGCAGAATGCCCAGTAGTACTGCGGCCAAGGGGACAGTTAGGAGACT
TCATCTAAAGCATGAAACCTAGCTCCTCTACACACAAATTCCTATGGAAATACCTTTGTG
TACAGTGTCTTACATTTTCCTATTAGTCAGAAAGAAGGAGAGAATGAGTGAGTGCTTGAA
ATGTGTCATACTGTTTTAGGATCAAGACTAGGAATTAGGAGCCAGGTTGACAAGGACTTT
TTCTGAGAGTTGGGTGAGGGTAAAGCTTTTCTATAATCAAGCTCAATACACCAAGGAAAC
TGGATCCAGAATTCCTAAACTTTAAAATGGTACTGTCTGCGGAGTGGAGTATGGATGGTT
ATGTCAAAGTCATAGTTCATCCTATCCAGATGTAGCATTCATGGTAAACTTTTAAGTGCT
AAGCAAGGAATTATTTACTGATTGGTTTTAAAGAGAGCAGAAAACACCCAAGTGTAGAAT
GTCTACTGTTTGCTACCTAGAAATCTTTTCCATTCCTCTTTCATACATTCCAACCCACTG
GAAGTCTTTAGAGGTATTTTGATTTAAAGTATACTTAAATTAGGATTTCTTAAAGAAAAC
ATAGGGAGAAAACTTTACATGCAATTAAAAATGGACTTTCCTGTGATTTGTTTTTAATCA
TTCATTTGGAGAAGAGGCATGACCTTTGTATTTCACTAAGTTTAAAGCAAGAGCAACTGA
TGATTAAATGTTGCTTTTTAATAAGGTTTTTAACTTGAAAATTTGAAAATATTTAATGTT
GAAAGACTTCAATTAGGGCTATTAGAGTTATATCTCCCTGTCGTAGGCAGCTTCTTCGGA
GAAGTGAAATATAACATTACTCAGTGGACGGAGAAATCTGTTTTGTTACAGAGACATGCC
TCTCAGAAGGTCAGGAGGTTTTGAGTACCTATCCTTGCCACCCATACAGGAAATCCAAAG
TTTGGTGTCTCTCTCTCTCTGTCTCTTTCTTTCTCTTTCTCCCCCCAAACCCCTCTCACT
CCCTCCCTCCCTCTCTCCTTCCCCTATTTGCAATCATATTCTCCCTCTGCTTCTTTTCTC
TTCTGCCCTCCTTGTGGGCAGTCATGAAAATCAATTCAGACTGTGTTGATTAGCAGATTT
ATTATTCTATTGAGAAAGCACTGGAATGTTTTGTGAGATTATTTTTATATGAAGGAATAG
CCTGAACTCAAACAGATGGTAAGAATAGTACAAACACCTTAGCACATCACTGCACACACA
GTATTCTGAAAGGAGATTTGACACTTAATTCCCATTTTCTTAAAATAACAGTTTTGTTGA
CTTAAAAATATGAGATACATAGGATGTGAAAAAAAATGTTTGCAGTACTCAGCAAAAAAT
AGGGTACATAAAGCAGGGTGGCTGTCCATCCACTGATTCTGGGGTGAGAAGCGATTTCTA
CCTCGCAAGAGTGACTAGAAAGTTTCTAGGAGCACCTCCAGGCTTGCAAAGAAAGTGAGG
CCTCTTGGTATCCTTTCCTCAGTGTGTATATGACAGCCAGTATAATCAATACCCTAGGTT
ATGCGTCTATATGATACTCATCTGTGAATATTATTGGTTTTGTAATCTTTGTTATATAAG
AGGATGTTTAGGCTGTATATACTGGGGTAGATTATTGCCTGCCCCTTATACATAGGAATA
TGCTGCATAATTGCGCATAACTTCCATCTCCCTTACTGGCTTGTAGGCAGAGGAAACTGT
ATATGTTACTGCCTTGTACTTTTCTCATACACCAAAAACACACCAAAAAAATCAATAAAA
TAAGCAATCTTCTATTCTCATTCCTTTTCCCACAGCAGCATATTTTAGAGGCACATACAA
AACCTACATTCTCTAGTTGGGAGTGGATTTTTAAAGTTTTCCTTTTATCTTTTATTTTTT
TTTGTATGATGCACTGAGATGTGTACTTTCTAACAGGGGATTGGTACCTAAGAAATGTGG
TAGCATTATTCAGAAAACTATTATACTTTCAAATGACACATAGTAAGGAGAATGGAATAA
TACATGTTGCATATTTGTTACCAGTTGTAATTTGTCTGTATTATGAAAGATGTAATGGTT
TGTCAGCTGTCACTGTTGTTTTCTTGTAACATGATATGGAATAAAGTATAGCAGAATCTC
CGTA

Protein Sequence

>5218 : length: 469
MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDEICVTKMSTRNCQGMDSVIK
PLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSS
PSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIR
EASLLKGLKHANIVLLHDIIHTKETLTLVFEYVHTDLCQYMDKHPGGLHPDNVKLFLFQL
LRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYRPP
DVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGV
HSLPHFKPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFS
DLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH