ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

51773

Name

RSF1

Synonym

HBXAP|RSF-1|XAP8|p325;remodeling and spacing factor 1;RSF1;remodeling and spacing factor 1

Definition

HBV pX associated protein-8|HBV pX-associated protein 8|hepatitis B virus x associated protein|hepatitis B virus x-associated protein|p325 subunit of RSF chromatin-remodeling complex

Position

11q14.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Chromosome Maintenance;Reactome;REACT:22172

External Links

Links to cell senescence gene database

51773

Links to epithelial mesenchymal transition gene database

51773

Links to ovarian cancer gene database

51773

Links to endometrial cancer gene database

51773

Links to iHOP

51773

Sequence Information

Nucleotide Sequence

>51773 : length: 11380
ATTGTGGGATCGCGGAGCCGTCCCTGAGACGCTGGGATCCGCAGAGGAGCCCACTTGAGA
GCGCCTCCTGTCGTCTGTAAGGTTGCCTTGCCATCCCTCGGCACCACAACTTCCCCCGCC
CCCCCATCGCCTCCTCCTCCATCCTCCAGTTCAAAATGGCGACGGCGGCGGCAGCGGCGG
CGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGCCCCAACTTCGCCGTAGTCTGCTCCT
TCTTGGAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGC
GGGTGCTGCAGGCGCCGCCGCCGGACGTCGGCAACGGAGAAGTACCAAAAGAATTGGTGG
AGCTCCATTTGAAGCTGATGAGGAAAATTGGCAAATCTGTTACTGCAGACAGATGGGAAA
AATATTTGATCAAGATATGCCAAGAGTTTAACAGTACCTGGGCATGGGAGATGGAGAAGA
AGGGCTATCTTGAAATGAGTGTTGAATGCAAACTAGCACTCTTAAAGTACCTCTGTGAGT
GTCAGTTTGATGACAATCTCAAATTCAAGAATATTATTAATGAGGAGGATGCCGATACTA
TGCGTCTCCAGCCAATTGGTCGAGACAAAGATGGCCTCATGTACTGGTACCAATTGGATC
AAGATCACAATGTCAGAATGTACATAGAAGAACAAGATGATCAAGATGGCTCTTCATGGA
AATGCATTGTCAGAAATCGAAACGAGTTGGCTGAGACTCTTGCACTCCTGAAAGCACAAA
TTGATCCTGTACTATTGAAAAACTCTAGCCAACAAGACAACTCTTCTCGGGAAAGTCCCA
GCTTAGAGGATGAGGAGACTAAAAAAGAGGAAGAAACACCTAAACAAGAGGAACAGAAAG
AAAGTGAAAAGATGAAAAGTGAGGAGCAGCCTATGGATTTAGAAAACCGTTCTACAGCCA
ATGTTCTAGAAGAGACTACTGTGAAAAAAGAAAAAGAAGATGAAAAGGAACTTGTGAAAC
TGCCAGTCATAGTGAAGCTAGAAAAACCTTTGCCAGAAAATGAAGAAAAAAAGATTATCA
AAGAAGAAAGTGATTCCTTCAAGGAAAATGTCAAACCCATTAAAGTTGAGGTGAAGGAAT
GTAGAGCAGATCCTAAAGATACCAAAAGTAGCATGGAGAAGCCAGTGGCACAGGAGCCTG
AAAGGATCGAATTTGGTGGCAATATTAAATCTTCTCACGAAATTACTGAGAAATCTACTG
AAGAAACTGAGAAACTTAAAAATGACCAGCAGGCCAAGATACCACTAAAAAAACGAGAAA
TTAAACTGAGTGATGATTTTGACAGTCCAGTCAAGGGACCTTTGTGTAAATCAGTTACTC
CAACAAAAGAGTTTTTGAAAGATGAAATAAAACAAGAGGAAGAGACTTGTAAAAGGATCT
CTACAATCACTGCTTTGGGTCATGAAGGGAAACAGCTGGTAAATGGAGAAGTTAGTGATG
AAAGGGTAGCTCCAAATTTTAAGACAGAACCAATAGAGACAAAGTTTTATGAGACAAAGG
AAGAGAGCTATAGCCCCTCTAAGGACAGAAATATCATCACGGAGGGAAATGGAACAGAGT
CCTTAAATTCTGTCATAACAAGTATGAAAACAGGTGAGCTTGAGAAAGAAACAGCCCCTT
TGAGGAAAGATGCAGATAGTTCAATATCAGTCTTAGAGATCCATAGTCAAAAAGCACAAA
TAGAGGAACCCGATCCTCCAGAAATGGAAACTTCTCTTGATTCTTCTGAGATGGCAAAAG
ATCTCTCTTCAAAAACTGCTTTATCTTCCACCGAGTCGTGTACCATGAAAGGTGAAGAGA
AGTCTCCCAAAACTAAGAAGGATAAGCGCCCACCAATCCTAGAATGTCTTGAAAAGTTAG
AGAAGTCCAAAAAGACTTTTCTTGATAAGGACGCACAAAGATTGAGTCCAATACCAGAAG
AAGTTCCAAAGAGTACTCTAGAGTCAGAAAAGCCTGGCTCTCCTGAGGCAGCTGAAACTT
CTCCACCATCTAATATCATTGACCACTGTGAGAAACTAGCCTCAGAAAAAGAAGTGGTAG
AATGCCAGAGTACAAGTACTGTTGGTGGCCAGTCTGTGAAAAAAGTAGACCTAGAAACCC
TAAAAGAGGATTCTGAGTTCACAAAGGTAGAAATGGATAATCTGGACAATGCCCAGACCT
CTGGCATAGAGGAGCCTTCTGAGACAAAGGGTTCTATGCAAAAAAGCAAATTCAAATATA
AGTTGGTTCCTGAAGAAGAAACCACTGCCTCAGAAAATACAGAGATAACCTCTGAAAGGC
AGAAAGAGGGCATCAAATTAACAATCAGGATATCAAGTCGGAAAAAGAAGCCCGATTCTC
CCCCCAAAGTTCTAGAACCAGAAAACAAGCAAGAGAAGACAGAAAAGGAAGAGGAGAAAA
CAAATGTGGGTCGTACTTTAAGAAGATCTCCAAGAATATCTAGACCCACTGCAAAAGTGG
CTGAGATCAGAGATCAGAAAGCTGATAAAAAAAGAGGGGAAGGAGAAGATGAGGTGGAAG
AAGAGTCAACAGCTTTGCAAAAAACTGACAAAAAGGAAATTTTGAAAAAATCAGAGAAAG
ATACAAATTCTAAAGTAAAACCCAAAGGCAAAGTTCGATGGACTGGTTCTCGGACACGTG
GCAGATGGAAATATTCCAGCAATGATGAAAGTGAAGGGTCTGGCAGTGAAAAATCATCTG
CAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGTGAAGAAGCCATCCTAGCAGATGATGATG
AACCATGCAAAAAATGTGGCCTTCCAAACCATCCTGAGCTAATTCTTCTGTGTGACTCTT
GCGATAGTGGATACCATACTGCCTGCCTTCGCCCTCCTCTGATGATCATCCCAGATGGAG
AATGGTTCTGCCCACCTTGCCAACATAAACTGCTCTGTGAAAAATTAGAGGAACAGTTGC
AGGATTTGGATGTTGCCTTAAAGAAGAAAGAGCGTGCCGAACGAAGAAAAGAACGCTTGG
TGTATGTTGGTATCAGTATTGAAAACATCATTCCTCCACAAGAGCCAGACTTTTCTGAAG
ATCAAGAAGAAAAGAAAAAAGATTCAAAAAAATCCAAAGCAAACTTGCTTGAAAGGAGGT
CAACAAGAACAAGGAAATGTATAAGCTACAGATTTGATGAGTTTGATGAAGCAATTGATG
AAGCTATTGAAGATGACATCAAAGAAGCCGATGGAGGAGGAGTTGGCCGAGGAAAAGATA
TCTCCACCATCACAGGTCATCGTGGGAAAGACATCTCTACTATTTTGGATGAAGAAAGAA
AAGAAAATAAACGACCCCAGAGGGCAGCTGCTGCTCGAAGGAAGAAACGCCGGCGATTAA
ATGATCTGGACAGTGATAGCAACCTGGATGAAGAAGAGAGCGAGGATGAATTCAAGATCA
GTGATGGATCTCAAGATGAGTTTGTTGTGTCTGATGAAAACCCAGATGAAAGTGAAGAAG
ATCCGCCATCTAATGATGACAGTGACACTGACTTTTGTAGCCGTAGACTGAGGCGACACC
CCTCTCGGCCAATGAGGCAGAGCAGGCGTTTGCGAAGAAAGACCCCAAAGAAAAAATATT
CCGATGATGATGAAGAGGAGGAATCTGAGGAGAATAGTAGAGACTCTGAAAGTGACTTCA
GTGATGATTTTAGTGATGATTTTGTAGAAACTCGGCGAAGGCGGTCAAGGAGAAATCAGA
AAAGACAAATTAACTACAAAGAAGACTCAGAAAGTGACGGTTCCCAGAAGAGTTTGCGAC
GTGGTAAAGAAATAAGGCGAGTACACAAGCGAAGACTTTCCAGCTCAGAGAGTGAAGAGA
GCTATTTGTCCAAGAACTCTGAAGATGATGAGCTAGCTAAAGAATCAAAGCGGTCAGTTC
GAAAGCGGGGCCGAAGCACAGACGAGTATTCAGAAGCAGATGAGGAGGAGGAGGAAGAGG
AAGGCAAACCATCCCGCAAACGGCTACACCGGATTGAGACGGATGAGGAGGAGAGTTGTG
ACAATGCTCATGGAGATGCAAATCAGCCTGCCCGTGACAGCCAGCCTAGGGTCCTGCCCT
CAGAACAAGAGAGCACCAAGAAGCCCTACCGGATAGAAAGTGATGAGGAAGAGGACTTTG
AAAATGTAGGCAAAGTGGGGAGCCCATTGGACTATAGCTTAGTGGACTTACCTTCAACCA
ATGGACAGAGCCCTGGCAAAGCCATTGAGAACTTGATTGGCAAGCCTACTGAGAAGTCTC
AGACCCCCAAGGACAACAGCACAGCCAGTGCAAGCCTAGCCTCCAATGGGACAAGTGGTG
GGCAGGAGGCAGGAGCACCAGAAGAGGAGGAAGATGAGCTTTTGAGAGTGACTGACCTTG
TTGATTATGTCTGTAACAGTGAACAGTTATAAGACTTTTTTTCCATTTTTGTGCTAATTT
ATTCCACGGTAGCTCTCACACCAGCGGGCCAGTTATTAAAAGCTGTTTAATTTTTCCTAG
AAAACTCCACTACAGAATGACTTTTAGAAGAAAAATTTCAACAAATCCTGAAGTCTTTCT
GTGAAGTGACCAGTTCTGAACTTTGAAGATAAATAATTGCTGTAAATTCCTTTTGATTTT
CTTTTTCCAGGTTCATGGTCCTTGGTAATTTCATTCATGGAAAAAAATCTTATTATAATA
ACAACAAAGATTTGTATATTTTTGACTTTATATTTCCTGAGCTCTCCTGACTTTGTGAAA
AAGGGTGGATGAAAATGCATTCCGAATCTGTGAGGGCCCAAAACAGAATTTAGGGGTGGG
TGAAAGCACTTGTGCTTTAGCTTTTTCATATTAAATATATATTATATTTAAACATTCATG
GCATAGATGATGATTTACAGACAATTTAAAAGTTCAAGTCTGTACTGTTACAGTTTGAGA
ATTGTAGATAACATCATACATAAGTCATTTAGTAACAGCCTTTGTGAAATGAACTTGTTT
ACTATTGGAGATAACCACACTTAATAAAGAAGAGACAGTGAAAGTACCATCATAATTAAC
CTAAATTTTTGTTATAGCAGAGTTTCTTGTTTAAAAAAAAATAAAATCATCTGAAAAGCA
TTTGTACAGTAAAATGTATAATGAAGCTTTGCCAACCAGACTGTGCTAGCAACAAATTTT
TTTAAATAAGCTTTATGCAGTGGTAATAAGGTGGCCTCAAATATATTGTGTCTGATGGAG
AGTTATTAGTGAAATGAATGTGGTCTTTCTTAAGGCCTGGGTGGACTGTAAACTTTGCCA
ATAGTATAACTCTTGTCTTCTGGCCACTTGATGTTTAAATATCTGAAATATCATTTTGAA
AAAAATACATCTATATATAACATACATGAAGAGATGCTAAGCTGACAGTGATATTTTAGC
ACATTTGAAGACTGGGAAGAGATTTTCAGGTGAATTTTAACTGGTCTATTCTTGCCCTTA
GTATCTACTTCAAATTGAAGTCTACAAACAAAGCAGTTCCTTTGGGAGGTTTTTAGTTTG
AGTTTTAGCGTGTGTGTGTGTTTGTGTGTGTGCGTGTGCGTGTGTGTGTGTGTTGGAATT
TCCTATCTGCCTGGATATATTAGCAGAGTTTGAATGTAGTTTTGGCCTTTGGCCATTAGA
CTTCTATTAAAATTCATTAATAGTCATACAACCAACATAGAGTTGAATGAGAACTGCCGA
TGTAATTAATAGGCATGACATCCATTTCAAACATCTCAACACTTTAAAGAAAAGCCCTTT
GTTTCAAGAAAAAAGGGTTTGTAACTAACTAAATACCTAACATGTAATTGACACTAAAAT
ATGAACTTTGTCTTATTTAGTTTCTGTTATAGCTGTAAAATTTCAGGCAGAGCCATAACA
TTGTACAGAGTGTAGCACTTGTGATTAAACCTAGCCTGTTAAATCCTGAAACCTTCAACC
ATTACTTCTGTGAATACTTTAGCCCTGGGATTTGGGTTTTTCTGTTCCGGTGTTGTGTCT
GTTGCCGGCAATGGACACACCATATCTGCTGCTGGCCCAAGGAACGTCATTAATTTTTCT
TTCCAAATTAAGTATTATGTGCTAGTCAGTGTATAGTAAAGCACTTCTCTTTTTTATTAC
TAAAAAGCTGGCATTAGATTTGCATTATAAATACCTCTCTAGGAACTTTATACTCCTTTT
CCTTCTTCAACAGGTATTGCCCTTAAATCTTATCTTTTGGCCTTGAAAGTTTATAGCTAT
TGTTTTTCAGTTGTTCGTTGTTTTGTTTTGTTTCACTTTAGTTCTGTAGTACCTGCCCAT
TAATATTTTTGCTTTGATTCTAGCAATGTGTATGTATCTGTATAAAAAATAAAATAATGA
AAGCAACCTAAAAATAGGATGCACCAATAGCATGTGGTTCCAAGTAAGTTGTGATTTTTA
TTTTGAGACAGTGTTCCACTGGAAGGGAGGGAAGGGCTTACATTCACAGACAGTAAAGCA
GGGCTGTGTAAGGAGCTACATTTACTTAACAGTCTCCTTTCCAGCTAGGTTTGTTTTATT
TATTTGCAAGTCAGCTAAGAATTAACCTTTTAAACCATCTAAAACAGGCAAGCAATATAA
AGATTTCTACTAGTGCAAGGTAAGTGGTTTGAATATACAAGTGCCCTTTCCTGCCACCCA
GTCTCACTACCGTTTTAGTCCTGCAGCTGGGTAAAGCCACTATTGTGTGGAAACTCTCCC
ATGTGCCCTGTCTCTACCTCTGGACACACCAGCTCCTTCTTCCACCTATTCTATTCCTCA
GTTAAGCCAAGTGATCAGAAGTAGTATTAAATGGGTAGATAATTTTAACAGGATGCCTAA
TGTGAAATAAGGAGTTATTTTTACTCTTCTACTATAGAAAGCCTAAGGTAATTCTTACCA
TCTCAAAGACTGAGTATTCCATTTAGGTTTGGAGACCACTTGTGCTGTGCTGCCTGATAT
TTACCAAACTTGAATAAGTGTTCGTCAACTTGATAGTGAATGTACCCCTTCTCACCTTAT
ATTTTGATTAAATCAATTAACTATAGGTCATCTACCAAGAATGTAATCCAAGCGGTTGAT
AAAACATTATTAGGCAGATAGATTATTGATTATTAAATTTTGAGCAGTGCAAAAACGGTT
TTGCTGCTTGGAGTTCAGATTCAGTCCCTCAAAGAGTTTATGATCACTGAAATACACTCT
GAAGGTATTCTGAAGAAGTTAAAAAATTTTAGAAAACGAAATGTTCTGTATACAAAGACA
ATACAGTCACTACGAACTGCAGAAAGTATAGGAAAGCAGTAATTGATGTAGAGTTTAGAC
AGTCTTGGATCTTTTTTAGAGCACTAACCATGGATTTAGACTCAAAATAGCTGCTACATA
ATAGAGCCCTTTAATAATTTAAACCCCCCTTGTTGAAATACAAGTTGGACTCCCAGTGTC
AAACTCTAGACTGTAGCTAATGTATTAAAGGGAGATGTAGATTAATATTCAGTATATTTA
GTTTGCAATTTCTGAAAAGGTTTGAAAACTAGTCAGCTTTTCACACAGCAGAAGCTTTGA
ACTGAAATATGTGTGAAAAGGACGCAGACTGAAAACGTTTTGGTTTTGTACATCAGTGCT
GATGAAATTAGTGTAAAACATTTTCCATCATTGGCACATTACTGCAAAATGATGGCAGAG
ATATTTTCAAGAATGTACATCAAGTTATATTTCCTTGACATCCTTTTTTCAATTGGTCAA
GGTTACAGATTCAGAGGATAAAGGGTAGTTTCATTTAGAATAAATTCATGTCTACTGGCA
ATCTATATATAAAAGTGACCTGCCCAAGAACCAAAAACTTTAAATGCTAATGAAGCTTTT
GAAAAATAATTTTTAAACAAATTAATTTTAAAAGGGTGTTACACGTACCCAGTTTTTACT
TTTTAGTTGATGAAACCCATCCTATAATATACATTTGAGCAAAGTACACATATTAAGAAA
AACATGGACATTTACTTGTTTAATAGTCAAAATGATGAGGAAATGTTAGCTGTTTTTAAG
TGGGACTGGTGGGGTGTCCTTTGTCACAAGGAATGCTTTTTTAGCTTGTTTGTGGGCATA
AGAGATGTTAACCCTTTGCTGATTCTACCACACAACTGTAAAGAACCTAATGAATCTACA
AGTTTAATATTCAGAAAAAGCTAGGAACTCCGCTCTTTACCAGTACAGTGGAACAGGCCC
GTTATTCAAGGTGATGCCTCACAGCTATAGAACAACTATTCAAAGACCCAGAGTTAAATG
GTACATGTGTATATGTGTGTGTGTGTGTGCACACGCACACACTTCAGATAAGTATCAGAA
AAAATAAAAATGAATCCATCATTAACTTGAAAGAAATAAGATGGCTGCATTGCAACAGAT
ACAAATATTATGAACATCATTTAATTACAGAAAATCTAGACAACAGTTTCTCCTGATGTT
TGACATTCTCAAAATATATTCCTCATTCTCGAAGAAGCAGAGAATGCCAAGGCTGCATAT
CTGCTGTAATCTACCTAGCCCTCTTCTGCTTAATATGATCCATTATTGAATCTTCTCAGA
TTAAAATCCATTCCTATATCATCTACCTTTCCCAAAGTGTGTGCCTGTAAACCTACCTTG
GAAGTGGCAAGTTAACTGATTTTTTTGTGTCATTTTTATACCAATCCTTAAGGTCAAAGC
CTTTTGCTATCAATGTATTTAAACTGAGTTGCTATATGTTCACTAATTTGTTTTCAAAAT
GTTTTGCTCCAACTTAAATTATCTTTTAACATCTTTTGAGTGCCAAGAATTGCTAAGTAA
CTGTAATATGTTGAAGAGAGTAATTGCCAAGCAAGCAGTCATAAGCCAAAATGTAATGAG
CTTAGTATATAACCACTTTAGAGTATACACTCACCACTTTTTGTATTCATTCATGCAAAC
CCTCCTGGAAGTCGATTAGAAGAGGATCCAATTTGTGGACCTTTTTTCCTCCTTTTGGAC
ACCTGAGCACAATTTTTTTTTTCCTTTCATATTTATACCACTTTGGAAAATTCAGTAAAC
CCAATTCTGGCACATCATAATGGTTTCAGTTAGTGAAGATGTTTATTTTAATAACTTTAA
AATATGACTATCCTATACATAAGTTATATAAGAGGGCATAACAATAGATGAGTAGAAATT
TATAAAATTTCTTGGATATTTTGAATGAGAAAAAAACATTTTTAAAGGAATTTTGTTTTT
TCCTTTTTTGGCCAAACCGGTACAAGTTAGAAAGTGTGCTAAGGACTGAATACTTGCCTC
GTGCTTTTTGCCACTGGATGATGTAAGTTAAGAATGGAATTGTTAATCCTAAGTATATAT
TTTCTTGACTTTCATCAGTTTCTAAAGAAATCTAATTTAAGTGTTTTGCGGTTTTGTTTG
ATCTGTATTTATTGAGTTCTGGTCATAGACCAGCAGCTTGCACGTCATGCTCATGAACAG
CCAGAACATAGTTATTGGGGAACTTCATGGCTCAAAACCTTCTGAATCATTTAACTTATT
TTGTATGTTGCAAAAAAAAAAAAAAAGTTTATTTTGCTTGAGAGTCACCTTTTTTTAAAA
AAAATAACTGTACAGCTTTTAAGGGATGGGAGGTGGGAAAATACCCTAAAATAGGATGTA
GATTTTTTACAATTGTGTTTATGCTAGATCATCTACAGGTGCATTATGTAATTAAACCTA
AAATTGTTTAAAAATTTGTGCCATGTCTTTTTCATTCTCCTGCCCTTTAGCAGAATTGGT
GCATGTCAACTGCTATGTGGACAAGCCTTGAAATTAGAGTAACAAGCCCTGTCTCCAAAG
CTTTAAGGTCACTGCATGAAAATTGCACACACACACACACACACACACACATCTAGCTTA
TATTAGTAAATGGATTTTCAGGATCAGAACAGCTACAGTAGCCCAGATTTGGCTGTTAAC
AGCATATTCTTACAGCACATGATTTTTGTGATGCCTAACTAGGGTATTCTCAATGTTAGT
CTGGTGTTCTATTCTCTTTCAAAGTAGCTTCTTGAGATGGTATCTGTTGTAGCTTGCCCA
AACCTGCCATGAGGTTGTGTGTACACTTTGAAAGGGTATGTCCTATGCTAAGATGGTGGT
AGAGCAGGGCTTGATTTTAATCTATTCATATAAAAGAAGGAAAAAACTAGAATTGGTCTA
TTTGGTTATTCAGTGGACTTAATTCCACAGGAATAGTTGTCTGCTGAAGCGTGGCAGCAA
GAGAAGTCAAATTCAAGTTTCAGTTCCTTCCTTATTCACTAAGTATTTTGAAATCTTGTA
GAACTTCTGATTCTAGCACAGTCTTTTACATGGCACATTTTACCATGGTATATTCACAGC
TTCGTTTAAATGTCAGTACTTTTTCCCATCTGATAATTTTGCCATTCTAATTTCTCACCT
TTGTAGTACAAGTGTATTCTTGAAAATAATTAAATTCATCTAAGTGTGTCATAATTTCAA
TCAAAGCTATATTCATGTGTTGCCAGCGTCAGTTTTTTGCTATCCTCATTCAGAAGGGAA
GCCTGCAGATCATGAGTTTCCATATGAAGAATACAAATTCCACATAAAAATTTATAAATG
GTATCTTTAGAATTTTGATTTAAAGTAATAGCTGGAATTCAGGGACTGATCAGAATGCCT
CTTGAATTTTCCAACATGCTTATATGAAATGCTTTATTTTCCTATGCGTTAAAAAAAATA
TTCCTGGAATAGGTTCTCAGAATGTTTTATTTGGTTTCTAGGAGATGAGATTTAAAGCAG
AAGCTCCAAGATTGGCATAAAACTAACTCTTGAGGTAATCAGGACCATGCTGTTAGTCAA
ATAGAAGCTGGAGTGCTCTCTGTCACATAATGTACTGCATGTGTGTGGGGGTGGGGGGGC
AGGGAAGATCAGAAAACTGGAAATGTAATTCTGATAACACGCAAAGTAAATTGTGCATTA
AAAGTATGGGAATTCTTGGTAGCTTAAAGCTTCAGGGGTTAACTTCAGTGTATGAACACC
TAGTGTGTTAGAATTGCAGTGCATAGTTGTTTAAATACAATATTCCTTGTAAGTGACAAC
CAAAATATGTTGTGGCTGGTGCCAGTATTTTTGTTAATGAAATGTTCAGTGTCTCACTAC
AGTCTGATCAGAACTCTTGGTGTTATAAGCCAGGCCTAAAGCCATTTTATAGCTATTGGC
CTAATTGTGTAACTTTTTCTTTCAAAATGTTTTATTATAATACTTCTGTCATTTCTTTCA
CTTAATATGTCAATTGTCATAATAAAAATTTAAATTTGAA

Protein Sequence

>51773 : length: 1441
MATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGN
GEVPKELVELHLKLMRKIGKSVTADRWEKYLIKICQEFNSTWAWEMEKKGYLEMSVECKL
ALLKYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQ
DDQDGSSWKCIVRNRNELAETLALLKAQIDPVLLKNSSQQDNSSRESPSLEDEETKKEEE
TPKQEEQKESEKMKSEEQPMDLENRSTANVLEETTVKKEKEDEKELVKLPVIVKLEKPLP
ENEEKKIIKEESDSFKENVKPIKVEVKECRADPKDTKSSMEKPVAQEPERIEFGGNIKSS
HEITEKSTEETEKLKNDQQAKIPLKKREIKLSDDFDSPVKGPLCKSVTPTKEFLKDEIKQ
EEETCKRISTITALGHEGKQLVNGEVSDERVAPNFKTEPIETKFYETKEESYSPSKDRNI
ITEGNGTESLNSVITSMKTGELEKETAPLRKDADSSISVLEIHSQKAQIEEPDPPEMETS
LDSSEMAKDLSSKTALSSTESCTMKGEEKSPKTKKDKRPPILECLEKLEKSKKTFLDKDA
QRLSPIPEEVPKSTLESEKPGSPEAAETSPPSNIIDHCEKLASEKEVVECQSTSTVGGQS
VKKVDLETLKEDSEFTKVEMDNLDNAQTSGIEEPSETKGSMQKSKFKYKLVPEEETTASE
NTEITSERQKEGIKLTIRISSRKKKPDSPPKVLEPENKQEKTEKEEEKTNVGRTLRRSPR
ISRPTAKVAEIRDQKADKKRGEGEDEVEEESTALQKTDKKEILKKSEKDTNSKVSKVKPK
GKVRWTGSRTRGRWKYSSNDESEGSGSEKSSAASEEEEEKESEEAILADDDEPCKKCGLP
NHPELILLCDSCDSGYHTACLRPPLMIIPDGEWFCPPCQHKLLCEKLEEQLQDLDVALKK
KERAERRKERLVYVGISIENIIPPQEPDFSEDQEEKKKDSKKSKANLLERRSTRTRKCIS
YRFDEFDEAIDEAIEDDIKEADGGGVGRGKDISTITGHRGKDISTILDEERKENKRPQRA
AAARRKKRRRLNDLDSDSNLDEEESEDEFKISDGSQDEFVVSDENPDESEEDPPSNDDSD
TDFCSRRLRRHPSRPMRQSRRLRRKTPKKKYSDDDEEEESEENSRDSESDFSDDFSDDFV
ETRRRRSRRNQKRQINYKEDSESDGSQKSLRRGKEIRRVHKRRLSSSESEESYLSKNSED
DELAKESKRSVRKRGRSTDEYSEADEEEEEEEGKPSRKRLHRIETDEEESCDNAHGDANQ
PARDSQPRVLPSEQESTKKPYRIESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAI
ENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQ
L