ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

51715

Name

RAB23

Synonym

HSPC137;RAB23, member RAS oncogene family;RAB23;RAB23, member RAS oncogene family

Definition

RAB family small GTP binding protein RAB 23|ras-related protein Rab-23

Position

6p11

Gene Type

protein-coding

Pathways and Diseases

Pathway

Hedgehog signaling events mediated by Gli proteins;PID Curated;200147

Pathway

Hedgehog signaling pathway;KEGG PATHWAY;hsa04340

Disease

Carpenter syndrome;OMIM

External Links

Links to cell senescence gene database

51715

Links to epithelial mesenchymal transition gene database

51715

Links to ovarian cancer gene database

51715

Links to endometrial cancer gene database

51715

Links to iHOP

51715

Sequence Information

Nucleotide Sequence

>51715 : length: 4837
ACGGCGCATGCTCCGCAGCGCGGCGGGTCCACAGATGAGGGGAGTCGAGACTCCCGCGCC
CCACCACCCCCGGCGGAGCTGCTGCTGAGCCACTCAATCTGAGCCCTGGCTACTAATAAA
GTTCGTTTAAAAATCATAATCATTCTTAAGAGAGCGAAAGAGGGTGCGAACTAGCCGCTC
GGCCCCGCAGGGAGAGCTGGCGCGTCGGGAGGAGACAGCGGCGGCAGCGGTTGCGCCGCG
ACCAGGAGGAGCCGGTGGCGCCGGGCGGCGGGTCCGCGGCCGGTGGGGGACGGTGAGTAG
CGGCTCGCGCTGCGGTGCAGCGGCGCTGCACTCACTCGCCCTCTCCAGGGGCTGGGGGTT
CGTCCGGCTCCACTGGGGAAGACTCAGCTTCTCCCCGGGGTCCCGGGTTGTGCCTTACTC
TCCGGAGTGGGCAGGGGTATCGAGGGCAGGGGCCTCCCGGCCCGGCTCCCCCATCCCCCG
GTTCGGACCGCCGAGCGCCGGCTCTCCCCTCCCTGAGCACCGATCCCAAGTTCCAGCTAG
AGAAGGTGGGCGGCAGCGCCAGCCCGGCGCCCCCTCCCAGCTCCCAGCGATTTGAGAGGG
AAGATCTGATCTCCTAGAATTAGAGTTGGTACAGAAACCATTTCAGCTCCAAAAATGTTG
GAGGAAGATATGGAAGTCGCCATAAAGATGGTGGTTGTAGGGAATGGAGCAGTTGGAAAA
TCAAGTATGATTCAGCGATATTGCAAAGGCATTTTTACAAAAGACTACAAGAAAACCATT
GGAGTTGATTTTTTGGAGCGACAAATTCAAGTTAATGATGAAGATGTCAGACTAATGTTA
TGGGACACTGCAGGTCAGGAGGAATTTGATGCAATTACAAAGGCCTACTATCGAGGAGCC
CAGGCTTGTGTGCTCGTGTTCTCTACCACAGATAGGGAATCTTTTGAAGCAGTTTCCAGT
TGGAGAGAGAAAGTAGTAGCCGAAGTGGGAGATATACCAACTGTACTTGTGCAAAACAAG
ATTGATCTTCTGGATGATTCTTGTATAAAGAATGAGGAAGCTGAGGCACTGGCAAAAAGG
TTAAAGTTAAGATTCTACAGAACATCAGTGAAAGAAGATCTAAATGTGAATGAAGTTTTT
AAGTATTTGGCTGAAAAATACCTTCAGAAACTCAAACAACAAATAGCTGAGGATCCAGAA
CTAACGCATTCAAGTAGTAACAAGATTGGTGTCTTTAATACATCTGGTGGAAGTCACTCC
GGTCAGAATTCAGGTACCCTCAATGGTGGAGATGTCATCAATCTTAGACCCAACAAACAA
AGGACCAAGAAAAACAGAAATCCTTTTAGCAGCTGTAGCATACCCTAAGATGTTTTGGGA
GGAAAACAATTGAATTACATTGTGCAATGCATTAAGAAACCCATCCAGCTGTCATGGTAT
GTTACAAGGTTTTCAGCAGACTTTGCTCCTAATGGCTCTCTGAAAGTGACAGACTTAAAT
ATTGCTCTGCAGTGCTTTTCAGAATGTAGAGTGAGACCTCTGGTGGAAAAATTATTGCCC
TGTGGACTCCTTTAATTTTTTTTACATTAGACGAAGCTTCTCCTGTTTGTAAAGGAATGC
TATAAGAAATTTCAAACACAGGTTTTGCGGAATTTTAAATGCTGGAAAACATAAATGAAA
TGCCTAAATATATTGTTACAGATTTTAATACTGTGGATCAAGGAAAGATAGCAAGCATTC
TTTTCCTGAAATTGGTCATGTAGCTTTTCTGCGAAATAGTATTGAATCTGAATACTTTCA
CAAAATAATACTGAAAGGTAAACCCTAAATCTTGCCAGACTGCATTAGTATTTTGGCATT
GAAACTTGTGCAATATCTGTGTAATGTAGAATGTGGGGTGTGCATGCAGATGTCTGGTAC
TGGAGTAAGCTGAAGGTATGTGCAGTATTTAAGAAAATGTACATTCTAATTAATTCACTT
ATAAAACCATTTACATATTGTGTATATGTTTTTATTTTCAAATGATAAACTCTAGACATA
TATTTTGCAAAATGAGCTTGGGTTTAAAAAGTGCTTTGTGCCAAAAATATCATACCTAAT
TTTTATAGTGCTTTACTATCAGAATTTATATTGTTTATTATATCTTTTAAAAGCAGTAAG
CAGTTTTCATCTGACAGCGTAGATAAAAGAGGAGTATAGGAATTTGAATGCTAGAGCATC
TCCCAGGTGAGCCTTATTGCAGATCTTTTTGATATAGTCACCCATAAGCATGGTGAGCTC
CTGCTCTCATAAGGTCAGCCAAAGCCCCTTAAGAAGGTACACAGCACATCTGCAGTCATT
CAGGAGGTCCTGTGAAGTGTGGTGATGCATCTAACACCTTTTGCTGCTCACTGAGAACCC
AGCTTTGAACTTACAAGATTACACTAACCATTTTTAAAGTGCACAAAAATATTATTATTA
GTCTTAACTAAAATTACATATTTTATAATGCCCTGCAACTCTAAACCATCCTTTTGTTTA
CACATTTTTGTATGGTATTTTAAGATTATCAATCACTTCAACATTTCTATAACCTTGTTT
GTATAGCACTTTCTCAAGAGCTGTCAGTCCCACATACAGAATCATTTCTTTTACAAAATG
ATTTAATATGTAATCATGTGTCAGGACATAAATTTTGTCACTTGGGACAGTAGCTTTCCA
GCTAAGATAATTGCGTGAACTCTGTTAAAACTGATTATCACTCATCAATGGCTTTATTTT
TAACCTATAAATAACCCCTTTCAATATACCTGGTTTTTACAGCATTGCAAAATCTGTAAA
AATAACTTTTATTGGAAAATGTCATGAAGTCATTTTTCATTATTTGTACTAAACAATGTT
TTATGTACTCCTTTTGTGTTTTATCTTTTGTTTTTCCATCTGTACTCCCCTCATCCTCCT
AATGTTGAGAAAATCAAATTTCCTGGGTGTGTCCTTGTTAAGTGATCAAAAGTAAATGTT
CTCTTTGCCATTTTAGATGGAAAAATAAAAAAAATTAAAAAGTAAATTTTTGCTTTTCAT
TATATTGAAATGATCTGGCATTATCTATTTCACAGTAATGTAAAATGCTTATTTTTATGT
CACCAGTTGTCACCACTCCCATTGCTGATAGTGACATAGGTTTTGGGGGCAAAATTCAGT
TCCTAACAAACAGTGGATACTGCTAATGAGTCATCTTTTCTACTCTCTTCAATTTTCTAC
TCTCTACTCTCCTCTTTAATTTTTGCACAAAATAATACTTTGCAACAAATAGTCTTTTGT
CTTTATTGGCAGAAAAATCACTTGTTATATGTGTTCTAGTTAGTTCTTTTTCATGTTAGC
TGTGTGGCTAAAAGCGTGTTACCTTTCTATATTTAAAAAAAGTAATCTCTGAGGATAGTT
ACAGTTCCTGTAATATAATTTTATGTACCTAGTTTTATCTTTTTTTAAATAAGAACTGAA
GAGAGAGCTTTGTTACATATTTGAATTTTTAATTTGCACTGCTGTATTTTAAACCTAACC
ATAATTAGTCATTTAAAATAATTAAGTAGGCCTGAAAGTCAGCCATGTTAATTTCTCAAT
TTAATCAATTCTTAAAGCCTTCAAAAATTGACATTTTTTTTCCAAGACCCTTCATTCTCT
TAAATAACTTTAATTTTATGAAACCATGTATACTAAAGAAAAACTTTTCCAAGATTCCAG
GTGATTGTGCATTTGTGCTCTAATCTACTTTTTTAACATTACGGCTAATCTTTTGCGTAG
ACATATCGCTGTGGAATAACTGCCATATTTCAGAGTTCCTCAGGTTTCCTTTTCCTTTTC
CAGTCTCTGTCTATGAATTAAATAGTATATAGAATGACCCATATAAGGCAATATAGTTAA
ATAAAACCAGGTTAAATGATTTCCTTTGTATCTGCCCAAAGTTGATAGCACACGTTACTT
TTTCAAAATAAAGCTAAAACTACCAAAAAGAGGATGAAAACTTTTTCCTCATTATGGAGT
GAAGTTCTAGGTGGTTGCTTTAGAAGTTGGCAGTGCAGTGCTCAGAAGGAACTCTCAATA
AATAACATGTACTCCTTGGACCTGTGAGTTTTAGGAAACTGGACCTTTTCTGAAGACCTT
AGAATAGGGAGTTGGCCTTAGGACCTAATGTCCCAACTTAGTGTTGGACCCTTTTAATAT
AAGATATTGTTAATTATTAGCATACTTTTCAAAACCTTTGAAATAGTTACTGCTAACCTG
ATAAAATGTTCCCATTAATCTATCATTAGTCTGTTTCTCTGAAAACAAAATGCATTGATG
AGGTGAAAGCTTGTTCCACATGGCACCTACCTAATGAACAGGACTTACTCAGTTTTTAAC
TGTTAAGAATGTCACATGTACTATTGTCACTCCTTAGGTTTTCAGCTATAAAACATGTAA
GTCTCTCATCATACAGATGAATTCATTTGCTAACAAAATATTTAAAACCCGCAGTAGACT
CTGAAATATCCAGTCATCAAACTCCTGGCTAACTGGATGATTTGGCTATAATAATCTTTA
TTATTATTATTTTCATCTGTCTCTCGAAATATCTACAGTAGGATGTTAGTAAATGGTCTT
TTAAAAGCAAAAAATTGGGGATAAAAGGAAAACTGAATTCCTTCTATATTTTTATTACTA
ATAAATAATGCTTTTGTAAATTTGAATGGAAAACCACTTGTATGTATTGCTATTTGGTTG
CAGTTACACTCTGGAGCTTAATTTAAAACACTACTCTAAAAATTTCATGAAGGATGAATT
CCAATAATCAGAAAATAAATGCATTTCAAAGCTAAAA

Protein Sequence

>51715 : length: 237
MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRL
MLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQ
NKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAED
PELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP