ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5159

Name

PDGFRB

Synonym

CD140B|IBGC4|IMF1|JTK12|PDGFR|PDGFR-1|PDGFR1;platelet-derived growth factor receptor, beta polypeptide;PDGFRB;platelet-derived growth factor receptor, beta polypeptide

Definition

CD140 antigen-like family member B|PDGF-R-beta|PDGFR-beta|beta-type platelet-derived growth factor receptor|platelet-derived growth factor receptor 1|platelet-derived growth factor receptor beta

Position

5q33.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

Signaling events mediated by TCPTP;PID Curated;200065

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

S1P1 pathway;PID Curated;200071

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

S1P3 pathway;PID Curated;200035

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Calcium signaling pathway;KEGG PATHWAY;hsa04020

Pathway

Angiogenesis;PANTHER;P00005

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

Nectin adhesion pathway;PID Curated;200053

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Disease

Glioma;KEGG DISEASE;H00042

Disease

Cancers of the nervous system;KEGG DISEASE

Disease

Myeloproliferative disorder with eosinophilia;OMIM

Disease

Cancers;KEGG DISEASE

Disease

Myelomonocytic leukemia, chronic;OMIM

External Links

Links to cell senescence gene database

5159

Links to epithelial mesenchymal transition gene database

5159

Links to ovarian cancer gene database

5159

Links to endometrial cancer gene database

5159

Links to iHOP

5159

Sequence Information

Nucleotide Sequence

>5159 : length: 6194
ATAGTGGTGTGAGCTCCTGAGGCTGCCAGCAGCCAGCAGTGACTGCCCGCCCTATCTGGG
ACCCAGGATCGCTCTGTGAGCAACTTGGAGCCAGAGAGGAGATCAACAAGGAGGAGGAGA
GAGCCGGCCCCTCAGCCCTGCTGCCCAGCAGCAGCCTGTGCTCGCCCTGCCCAACGCAGA
CAGCCAGACCCAGGGCGGCCCCTCTGGCGGCTCTGCTCCTCCCGAAGGATGCTTGGGGAG
TGAGGCGAAGCTGGGCCGCTCCTCTCCCCTACAGCAGCCCCCTTCCTCCATCCCTCTGTT
CTCCTGAGCCTTCAGGAGCCTGCACCAGTCCTGCCTGTCCTTCTACTCAGCTGTTACCCA
CTCTGGGACCAGCAGTCTTTCTGATAACTGGGAGAGGGCAGTAAGGAGGACTTCCTGGAG
GGGGTGACTGTCCAGAGCCTGGAACTGTGCCCACACCAGAAGCCATCAGCAGCAAGTGCC
CAGCCCTGGATAGGCAGTGCGGCTGAAAAAATGTCCTGGTGAAAGGGAGGAGGAGCTCAC
TGAAGACCTTCTGCTCCCAAGTGTGAGACTAGAACCCAGGCCTCCAGCCTTCTCACAGGT
GCCCTTCCAGGACATCGTGTGGCTACTCCAGGCAGCATTCCTCCATTGCAAGCAGGGAGG
AGTATCTCTGCTTCCCTCTGTGACCTCCCAATTGCACAGAGGCCTCTAGTGACAAGTTCT
GAAGTCATGCAGTCCTCCCCTGTCTCCAAGCAGGAGACCCTGAATCCACAGCCTTCAGGG
ACATACAGTCCCTGAACACCTACCTCATGCAGGCATAGAGCCTGGTACTTCACACACCTT
GGAGTCCTCATGGCAAGTTTTTGAAATCAGTGTTATTACCTACTTTTTGTAGATGAGGAA
GCTGAGATCTGGAGAGGCTAAGTGACTTTCCCAGGGCCATACGGACACCATGCGGCTTCC
GGGTGCGATGCCAGCTCTGGCCCTCAAAGGCGAGCTGCTGTTGCTGTCTCTCCTGTTACT
TCTGGAACCACAGATCTCTCAGGGCCTGGTCGTCACACCCCCGGGGCCAGAGCTTGTCCT
CAATGTCTCCAGCACCTTCGTTCTGACCTGCTCGGGTTCAGCTCCGGTGGTGTGGGAACG
GATGTCCCAGGAGCCCCCACAGGAAATGGCCAAGGCCCAGGATGGCACCTTCTCCAGCGT
GCTCACACTGACCAACCTCACTGGGCTAGACACGGGAGAATACTTTTGCACCCACAATGA
CTCCCGTGGACTGGAGACCGATGAGCGGAAACGGCTCTACATCTTTGTGCCAGATCCCAC
CGTGGGCTTCCTCCCTAATGATGCCGAGGAACTATTCATCTTTCTCACGGAAATAACTGA
GATCACCATTCCATGCCGAGTAACAGACCCACAGCTGGTGGTGACACTGCACGAGAAGAA
AGGGGACGTTGCACTGCCTGTCCCCTATGATCACCAACGTGGCTTTTCTGGTATCTTTGA
GGACAGAAGCTACATCTGCAAAACCACCATTGGGGACAGGGAGGTGGATTCTGATGCCTA
CTATGTCTACAGACTCCAGGTGTCATCCATCAACGTCTCTGTGAACGCAGTGCAGACTGT
GGTCCGCCAGGGTGAGAACATCACCCTCATGTGCATTGTGATCGGGAATGAGGTGGTCAA
CTTCGAGTGGACATACCCCCGCAAAGAAAGTGGGCGGCTGGTGGAGCCGGTGACTGACTT
CCTCTTGGATATGCCTTACCACATCCGCTCCATCCTGCACATCCCCAGTGCCGAGTTAGA
AGACTCGGGGACCTACACCTGCAATGTGACGGAGAGTGTGAATGACCATCAGGATGAAAA
GGCCATCAACATCACCGTGGTTGAGAGCGGCTACGTGCGGCTCCTGGGAGAGGTGGGCAC
ACTACAATTTGCTGAGCTGCATCGGAGCCGGACACTGCAGGTAGTGTTCGAGGCCTACCC
ACCGCCCACTGTCCTGTGGTTCAAAGACAACCGCACCCTGGGCGACTCCAGCGCTGGCGA
AATCGCCCTGTCCACGCGCAACGTGTCGGAGACCCGGTATGTGTCAGAGCTGACACTGGT
TCGCGTGAAGGTGGCAGAGGCTGGCCACTACACCATGCGGGCCTTCCATGAGGATGCTGA
GGTCCAGCTCTCCTTCCAGCTACAGATCAATGTCCCTGTCCGAGTGCTGGAGCTAAGTGA
GAGCCACCCTGACAGTGGGGAACAGACAGTCCGCTGTCGTGGCCGGGGCATGCCCCAGCC
GAACATCATCTGGTCTGCCTGCAGAGACCTCAAAAGGTGTCCACGTGAGCTGCCGCCCAC
GCTGCTGGGGAACAGTTCCGAAGAGGAGAGCCAGCTGGAGACTAACGTGACGTACTGGGA
GGAGGAGCAGGAGTTTGAGGTGGTGAGCACACTGCGTCTGCAGCACGTGGATCGGCCACT
GTCGGTGCGCTGCACGCTGCGCAACGCTGTGGGCCAGGACACGCAGGAGGTCATCGTGGT
GCCACACTCCTTGCCCTTTAAGGTGGTGGTGATCTCAGCCATCCTGGCCCTGGTGGTGCT
CACCATCATCTCCCTTATCATCCTCATCATGCTTTGGCAGAAGAAGCCACGTTACGAGAT
CCGATGGAAGGTGATTGAGTCTGTGAGCTCTGACGGCCATGAGTACATCTACGTGGACCC
CATGCAGCTGCCCTATGACTCCACGTGGGAGCTGCCGCGGGACCAGCTTGTGCTGGGACG
CACCCTCGGCTCTGGGGCCTTTGGGCAGGTGGTGGAGGCCACGGCTCATGGCCTGAGCCA
TTCTCAGGCCACGATGAAAGTGGCCGTCAAGATGCTTAAATCCACAGCCCGCAGCAGTGA
GAAGCAAGCCCTTATGTCGGAGCTGAAGATCATGAGTCACCTTGGGCCCCACCTGAACGT
GGTCAACCTGTTGGGGGCCTGCACCAAAGGAGGACCCATCTATATCATCACTGAGTACTG
CCGCTACGGAGACCTGGTGGACTACCTGCACCGCAACAAACACACCTTCCTGCAGCACCA
CTCCGACAAGCGCCGCCCGCCCAGCGCGGAGCTCTACAGCAATGCTCTGCCCGTTGGGCT
CCCCCTGCCCAGCCATGTGTCCTTGACCGGGGAGAGCGACGGTGGCTACATGGACATGAG
CAAGGACGAGTCGGTGGACTATGTGCCCATGCTGGACATGAAAGGAGACGTCAAATATGC
AGACATCGAGTCCTCCAACTACATGGCCCCTTACGATAACTACGTTCCCTCTGCCCCTGA
GAGGACCTGCCGAGCAACTTTGATCAACGAGTCTCCAGTGCTAAGCTACATGGACCTCGT
GGGCTTCAGCTACCAGGTGGCCAATGGCATGGAGTTTCTGGCCTCCAAGAACTGCGTCCA
CAGAGACCTGGCGGCTAGGAACGTGCTCATCTGTGAAGGCAAGCTGGTCAAGATCTGTGA
CTTTGGCCTGGCTCGAGACATCATGCGGGACTCGAATTACATCTCCAAAGGCAGCACCTT
TTTGCCTTTAAAGTGGATGGCTCCGGAGAGCATCTTCAACAGCCTCTACACCACCCTGAG
CGACGTGTGGTCCTTCGGGATCCTGCTCTGGGAGATCTTCACCTTGGGTGGCACCCCTTA
CCCAGAGCTGCCCATGAACGAGCAGTTCTACAATGCCATCAAACGGGGTTACCGCATGGC
CCAGCCTGCCCATGCCTCCGACGAGATCTATGAGATCATGCAGAAGTGCTGGGAAGAGAA
GTTTGAGATTCGGCCCCCCTTCTCCCAGCTGGTGCTGCTTCTCGAGAGACTGTTGGGCGA
AGGTTACAAAAAGAAGTACCAGCAGGTGGATGAGGAGTTTCTGAGGAGTGACCACCCAGC
CATCCTTCGGTCCCAGGCCCGCTTGCCTGGGTTCCATGGCCTCCGATCTCCCCTGGACAC
CAGCTCCGTCCTCTATACTGCCGTGCAGCCCAATGAGGGTGACAACGACTATATCATCCC
CCTGCCTGACCCCAAACCCGAGGTTGCTGACGAGGGCCCACTGGAGGGTTCCCCCAGCCT
AGCCAGCTCCACCCTGAATGAAGTCAACACCTCCTCAACCATCTCCTGTGACAGCCCCCT
GGAGCCCCAGGACGAACCAGAGCCAGAGCCCCAGCTTGAGCTCCAGGTGGAGCCGGAGCC
AGAGCTGGAACAGTTGCCGGATTCGGGGTGCCCTGCGCCTCGGGCGGAAGCAGAGGATAG
CTTCCTGTAGGGGGCTGGCCCCTACCCTGCCCTGCCTGAAGCTCCCCCCCTGCCAGCACC
CAGCATCTCCTGGCCTGGCCTGACCGGGCTTCCTGTCAGCCAGGCTGCCCTTATCAGCTG
TCCCCTTCTGGAAGCTTTCTGCTCCTGACGTGTTGTGCCCCAAACCCTGGGGCTGGCTTA
GGAGGCAAGAAAACTGCAGGGGCCGTGACCAGCCCTCTGCCTCCAGGGAGGCCAACTGAC
TCTGAGCCAGGGTTCCCCCAGGGAACTCAGTTTTCCCATATGTAAAATGGGAAAGTTAGG
CTTGATGACCCAGAATCTAGGATTCTCTCCCTGGCTGACAGGTGGGGAGACCGAATCCCT
CCCTGGGAAGATTCTTGGAGTTACTGAGGTGGTAAATTAACTTTTTTCTGTTCAGCCAGC
TACCCCTCAAGGAATCATAGCTCTCTCCTCGCACTTTTATCCACCCAGGAGCTAGGGAAG
AGACCCTAGCCTCCCTGGCTGCTGGCTGAGCTAGGGCCTAGCCTTGAGCAGTGTTGCCTC
ATCCAGAAGAAAGCCAGTCTCCTCCCTATGATGCCAGTCCCTGCGTTCCCTGGCCCGAGC
TGGTCTGGGGCCATTAGGCAGCCTAATTAATGCTGGAGGCTGAGCCAAGTACAGGACACC
CCCAGCCTGCAGCCCTTGCCCAGGGCACTTGGAGCACACGCAGCCATAGCAAGTGCCTGT
GTCCCTGTCCTTCAGGCCCATCAGTCCTGGGGCTTTTTCTTTATCACCCTCAGTCTTAAT
CCATCCACCAGAGTCTAGAAGGCCAGACGGGCCCCGCATCTGTGATGAGAATGTAAATGT
GCCAGTGTGGAGTGGCCACGTGTGTGTGCCAGTATATGGCCCTGGCTCTGCATTGGACCT
GCTATGAGGCTTTGGAGGAATCCCTCACCCTCTCTGGGCCTCAGTTTCCCCTTCAAAAAA
TGAATAAGTCGGACTTATTAACTCTGAGTGCCTTGCCAGCACTAACATTCTAGAGTATTC
CAGGTGGTTGCACATTTGTCCAGATGAAGCAAGGCCATATACCCTAAACTTCCATCCTGG
GGGTCAGCTGGGCTCCTGGGAGATTCCAGATCACACATCACACTCTGGGGACTCAGGAAC
CATGCCCCTTCCCCAGGCCCCCAGCAAGTCTCAAGAACACAGCTGCACAGGCCTTGACTT
AGAGTGACAGCCGGTGTCCTGGAAAGCCCCCAGCAGCTGCCCCAGGGACATGGGAAGACC
ACGGGACCTCTTTCACTACCCACGATGACCTCCGGGGGTATCCTGGGCAAAAGGGACAAA
GAGGGCAAATGAGATCACCTCCTGCAGCCCACCACTCCAGCACCTGTGCCGAGGTCTGCG
TCGAAGACAGAATGGACAGTGAGGACAGTTATGTCTTGTAAAAGACAAGAAGCTTCAGAT
GGGTACCCCAAGAAGGATGTGAGAGGTGGGCGCTTTGGAGGTTTGCCCCTCACCCACCAG
CTGCCCCATCCCTGAGGCAGCGCTCCATGGGGGTATGGTTTTGTCACTGCCCAGACCTAG
CAGTGACATCTCATTGTCCCCAGCCCAGTGGGCATTGGAGGTGCCAGGGGAGTCAGGGTT
GTAGCCAAGACGCCCCCGCACGGGGAGGGTTGGGAAGGGGGTGCAGGAAGCTCAACCCCT
CTGGGCACCAACCCTGCATTGCAGGTTGGCACCTTACTTCCCTGGGATCCCCAGAGTTGG
TCCAAGGAGGGAGAGTGGGTTCTCAATACGGTACCAAAGATATAATCACCTAGGTTTACA
AATATTTTTAGGACTCACGTTAACTCACATTTATACAGCAGAAATGCTATTTTGTATGCT
GTTGAGTTTTTCTATCTGTGTACTTTTTTTTAAGGGAAAGATTTTAATATTAAACCTGGT
GCTTCTCACTCACA

Protein Sequence

>5159 : length: 1106
MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVLNVSSTFVLTCSGSAPV
VWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFV
PDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQV
EPEPELEQLPDSGCPAPRAEAEDSFL