ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5156

Name

PDGFRA

Synonym

CD140A|PDGFR-2|PDGFR2|RHEPDGFRA;platelet-derived growth factor receptor, alpha polypeptide;PDGFRA;platelet-derived growth factor receptor, alpha polypeptide

Definition

CD140 antigen-like family member A|CD140a antigen|PDGF-R-alpha|PDGFRA/BCR fusion|alpha-type platelet-derived growth factor receptor|platelet-derived growth factor receptor 2|platelet-derived growth factor receptor alpha|rearranged-in-hypereosinophilia-pla

Position

4q12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

role of pi3k subunit p85 in regulation of actin organization and cell migration;PID BioCarta;100211

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

rac1 cell motility signaling pathway;PID BioCarta;100056

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

Calcium signaling pathway;KEGG PATHWAY;hsa04020

Pathway

Angiogenesis;PANTHER;P00005

Pathway

pdgf signaling pathway;PID BioCarta;100077

Pathway

phospholipids as signalling intermediaries;PID BioCarta;100183

Pathway

PDGFR-alpha signaling pathway;PID Curated;200140

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Disease

Cancers of the nervous system;KEGG DISEASE

Disease

Height;NHGRI

Disease

Cancers;KEGG DISEASE

Disease

Hematological and biochemical traits;NHGRI

Disease

Glioma;KEGG DISEASE;H00042

Disease

heart transplant complications;GAD

Disease

IMMUNE;GAD

Disease

CARDIOVASCULAR;GAD

Disease

neural tube defects;GAD

Disease

Asthma;GAD

Disease

Gastrointestinal stromal tumor, somatic;OMIM

Disease

Hypereosinophilic syndrome, idiopathic, resistant to imatinib;OMIM

Disease

DEVELOPMENTAL;GAD

Disease

height;GAD

External Links

Links to cell senescence gene database

5156

Links to epithelial mesenchymal transition gene database

5156

Links to ovarian cancer gene database

5156

Links to endometrial cancer gene database

5156

Links to iHOP

5156

Sequence Information

Nucleotide Sequence

>5156 : length: 6608
AGCGCAGGGAGTTTGAGAGAAACTTTTATTTTGAAGAGACCAAGGTTGAGGGGGGGCTTA
TTTCCTGACAGCTATTTACTTAGAGCAAATGATTAGTTTTAGAAGGATGGACTATAACAT
TGAATCAATTACAAAACGCGGTTTTTGAGCCCATTACTGTTGGAGCTACAGGGAGAGAAA
CAGAGGAGGAGACTGCAAGAGATCATTGGAGGCCGTGGGCACGCTCTTTACTCCATGTGT
GGGACATTCATTGCGGAATAACATCGGAGGAGAAGAGACGGGGTTTTGCCATGCTGCCTA
GACTGGTCTTGAACTCCTGGGCTCAAATGATCTGCCTGCCTCAGCTTCCCAAGTTTCCCA
GAGCTATGGGGACTTCCCATCCGGCGTTCCTGGTCTTAGGCTGTCTTCTCACAGGGCTGA
GCCTAATCCTCTGCCAGCTTTCATTACCCTCTATCCTTCCAAATGAAAATGAAAAGGTTG
TGCAGCTGAATTCATCCTTTTCTCTGAGATGCTTTGGGGAGAGTGAAGTGAGCTGGCAGT
ACCCCATGTCTGAAGAAGAGAGCTCCGATGTGGAAATCAGAAATGAAGAAAACAACAGCG
GCCTTTTTGTGACGGTCTTGGAAGTGAGCAGTGCCTCGGCGGCCCACACAGGGTTGTACA
CTTGCTATTACAACCACACTCAGACAGAAGAGAATGAGCTTGAAGGCAGGCACATTTACA
TCTATGTGCCAGACCCAGATGTAGCCTTTGTACCTCTAGGAATGACGGATTATTTAGTCA
TCGTGGAGGATGATGATTCTGCCATTATACCTTGTCGCACAACTGATCCCGAGACTCCTG
TAACCTTACACAACAGTGAGGGGGTGGTACCTGCCTCCTACGACAGCAGACAGGGCTTTA
ATGGGACCTTCACTGTAGGGCCCTATATCTGTGAGGCCACCGTCAAAGGAAAGAAGTTCC
AGACCATCCCATTTAATGTTTATGCTTTAAAAGCAACATCAGAGCTGGATCTAGAAATGG
AAGCTCTTAAAACCGTGTATAAGTCAGGGGAAACGATTGTGGTCACCTGTGCTGTTTTTA
ACAATGAGGTGGTTGACCTTCAATGGACTTACCCTGGAGAAGTGAAAGGCAAAGGCATCA
CAATGCTGGAAGAAATCAAAGTCCCATCCATCAAATTGGTGTACACTTTGACGGTCCCCG
AGGCCACGGTGAAAGACAGTGGAGATTACGAATGTGCTGCCCGCCAGGCTACCAGGGAGG
TCAAAGAAATGAAGAAAGTCACTATTTCTGTCCATGAGAAAGGTTTCATTGAAATCAAAC
CCACCTTCAGCCAGTTGGAAGCTGTCAACCTGCATGAAGTCAAACATTTTGTTGTAGAGG
TGCGGGCCTACCCACCTCCCAGGATATCCTGGCTGAAAAACAATCTGACTCTGATTGAAA
ATCTCACTGAGATCACCACTGATGTGGAAAAGATTCAGGAAATAAGGTATCGAAGCAAAT
TAAAGCTGATCCGTGCTAAGGAAGAAGACAGTGGCCATTATACTATTGTAGCTCAAAATG
AAGATGCTGTGAAGAGCTATACTTTTGAACTGTTAACTCAAGTTCCTTCATCCATTCTGG
ACTTGGTCGATGATCACCATGGCTCAACTGGGGGACAGACGGTGAGGTGCACAGCTGAAG
GCACGCCGCTTCCTGATATTGAGTGGATGATATGCAAAGATATTAAGAAATGTAATAATG
AAACTTCCTGGACTATTTTGGCCAACAATGTCTCAAACATCATCACGGAGATCCACTCCC
GAGACAGGAGTACCGTGGAGGGCCGTGTGACTTTCGCCAAAGTGGAGGAGACCATCGCCG
TGCGATGCCTGGCTAAGAATCTCCTTGGAGCTGAGAACCGAGAGCTGAAGCTGGTGGCTC
CCACCCTGCGTTCTGAACTCACGGTGGCTGCTGCAGTCCTGGTGCTGTTGGTGATTGTGA
TCATCTCACTTATTGTCCTGGTTGTCATTTGGAAACAGAAACCGAGGTATGAAATTCGCT
GGAGGGTCATTGAATCAATCAGCCCAGATGGACATGAATATATTTATGTGGACCCGATGC
AGCTGCCTTATGACTCAAGATGGGAGTTTCCAAGAGATGGACTAGTGCTTGGTCGGGTCT
TGGGGTCTGGAGCGTTTGGGAAGGTGGTTGAAGGAACAGCCTATGGATTAAGCCGGTCCC
AACCTGTCATGAAAGTTGCAGTGAAGATGCTAAAACCCACGGCCAGATCCAGTGAAAAAC
AAGCTCTCATGTCTGAACTGAAGATAATGACTCACCTGGGGCCACATTTGAACATTGTAA
ACTTGCTGGGAGCCTGCACCAAGTCAGGCCCCATTTACATCATCACAGAGTATTGCTTCT
ATGGAGATTTGGTCAACTATTTGCATAAGAATAGGGATAGCTTCCTGAGCCACCACCCAG
AGAAGCCAAAGAAAGAGCTGGATATCTTTGGATTGAACCCTGCTGATGAAAGCACACGGA
GCTATGTTATTTTATCTTTTGAAAACAATGGTGACTACATGGACATGAAGCAGGCTGATA
CTACACAGTATGTCCCCATGCTAGAAAGGAAAGAGGTTTCTAAATATTCCGACATCCAGA
GATCACTCTATGATCGTCCAGCCTCATATAAGAAGAAATCTATGTTAGACTCAGAAGTCA
AAAACCTCCTTTCAGATGATAACTCAGAAGGCCTTACTTTATTGGATTTGTTGAGCTTCA
CCTATCAAGTTGCCCGAGGAATGGAGTTTTTGGCTTCAAAAAATTGTGTCCACCGTGATC
TGGCTGCTCGCAACGTCCTCCTGGCACAAGGAAAAATTGTGAAGATCTGTGACTTTGGCC
TGGCCAGAGACATCATGCATGATTCGAACTATGTGTCGAAAGGCAGTACCTTTCTGCCCG
TGAAGTGGATGGCTCCTGAGAGCATCTTTGACAACCTCTACACCACACTGAGTGATGTCT
GGTCTTATGGCATTCTGCTCTGGGAGATCTTTTCCCTTGGTGGCACCCCTTACCCCGGCA
TGATGGTGGATTCTACTTTCTACAATAAGATCAAGAGTGGGTACCGGATGGCCAAGCCTG
ACCACGCTACCAGTGAAGTCTACGAGATCATGGTGAAATGCTGGAACAGTGAGCCGGAGA
AGAGACCCTCCTTTTACCACCTGAGTGAGATTGTGGAGAATCTGCTGCCTGGACAATATA
AAAAGAGTTATGAAAAAATTCACCTGGACTTCCTGAAGAGTGACCATCCTGCTGTGGCAC
GCATGCGTGTGGACTCAGACAATGCATACATTGGTGTCACCTACAAAAACGAGGAAGACA
AGCTGAAGGACTGGGAGGGTGGTCTGGATGAGCAGAGACTGAGCGCTGACAGTGGCTACA
TCATTCCTCTGCCTGACATTGACCCTGTCCCTGAGGAGGAGGACCTGGGCAAGAGGAACA
GACACAGCTCGCAGACCTCTGAAGAGAGTGCCATTGAGACGGGTTCCAGCAGTTCCACCT
TCATCAAGAGAGAGGACGAGACCATTGAAGACATCGACATGATGGATGACATCGGCATAG
ACTCTTCAGACCTGGTGGAAGACAGCTTCCTGTAACTGGCGGATTCGAGGGGTTCCTTCC
ACTTCTGGGGCCACCTCTGGATCCCGTTCAGAAAACCACTTTATTGCAATGCAGAGGTTG
AGAGGAGGACTTGGTTGATGTTTAAAGAGAAGTTCCCAGCCAAGGGCCTCGGGGAGCGTT
CTAAATATGAATGAATGGGATATTTTGAAATGAACTTTGTCAGTGTTGCCTCTTGCAATG
CCTCAGTAGCATCTCAGTGGTGTGTGAAGTTTGGAGATAGATGGATAAGGGAATAATAGG
CCACAGAAGGTGAACTTTGTGCTTCAAGGACATTGGTGAGAGTCCAACAGACACAATTTA
TACTGCGACAGAACTTCAGCATTGTAATTATGTAAATAACTCTAACCAAGGCTGTGTTTA
GATTGTATTAACTATCTTCTTTGGACTTCTGAAGAGACCACTCAATCCATCCATGTACTT
CCCTCTTGAAACCTGATGTCAGCTGCTGTTGAACTTTTTAAAGAAGTGCATGAAAAACCA
TTTTTGAACCTTAAAAGGTACTGGTACTATAGCATTTTGCTATCTTTTTTAGTGTTAAAG
AGATAAAGAATAATAATTAACCAACCTTGTTTAATAGATTTGGGTCATTTAGAAGCCTGA
CAACTCATTTTCATATTGTAATCTATGTTTATAATACTACTACTGTTATCAGTAATGCTA
AATGTGTAATAATGTAACATGATTTCCCTCCAGAGAAAGCACAATTTAAAACAATCCTTA
CTAAGTAGGTGATGAGTTTGACAGTTTTTGACATTTATATTAAATAACATGTTTCTCTAT
AAAGTATGGTAATAGCTTTAGTGAATTAAATTTAGTTGAGCATAGAGAACAAAGTAAAAG
TAGTGTTGTCCAGGAAGTCAGAATTTTTAACTGTACTGAATAGGTTCCCCAATCCATCGT
ATTAAAAAACAATTAACTGCCCTCTGAAATAATGGGATTAGAAACAAACAAAACTCTTAA
GTCCTAAAAGTTCTCAATGTAGAGGCATAAACCTGTGCTGAACATAACTTCTCATGTATA
TTACCCAATGGAAAATATAATGATCAGCAAAAAGACTGGATTTGCAGAAGTTTTTTTTTT
TTTTTTCTTCATGCCTGATGAAAGCTTTGGCGACCCCAATATATGTATTTTTTGAATCTA
TGAACCTGAAAAGGGTCAGAAGGATGCCCAGACATCAGCCTCCTTCTTTCACCCCTTACC
CCAAAGAGAAAGAGTTTGAAACTCGAGACCATAAAGATATTCTTTAGTGGAGGCTGGATG
TGCATTAGCCTGGATCCTCAGTTCTCAAATGTGTGTGGCAGCCAGGATGACTAGATCCTG
GGTTTCCATCCTTGAGATTCTGAAGTATGAAGTCTGAGGGAAACCAGAGTCTGTATTTTT
CTAAACTCCCTGGCTGTTCTGATCGGCCAGTTTTCGGAAACACTGACTTAGGTTTCAGGA
AGTTGCCATGGGAAACAAATAATTTGAACTTTGGAACAGGGTTGGCATTCAACCACGCAG
GAAGCCTACTATTTAAATCCTTGGCTTCAGGTTAGTGACATTTAATGCCATCTAGCTAGC
AATTGCGACCTTAATTTAACTTTCCAGTCTTAGCTGAGGCTGAGAAAGCTAAAGTTTGGT
TTTGACAGGTTTTCCAAAAGTAAAGATGCTACTTCCCACTGTATGGGGGAGATTGAACTT
TCCCCGTCTCCCGTCTTCTGCCTCCCACTCCATACCCCGCCAAGGAAAGGCATGTACAAA
AATTATGCAATTCAGTGTTCCAAGTCTCTGTGTAACCAGCTCAGTGTTTTGGTGGAAAAA
ACATTTTAAGTTTTACTGATAATTTGAGGTTAGATGGGAGGATGAATTGTCACATCTATC
CACACTGTCAAACAGGTTGGTGTGGGTTCATTGGCATTCTTTGCAATACTGCTTAATTGC
TGATACCATATGAATGAAACATGGGCTGTGATTACTGCAATCACTGTGCTATCGGCAGAT
GATGCTTTGGAAGATGCAGAAGCAATAATAAAGTACTTGACTACCTACTGGTGTAATCTC
AATGCAAGCCCCAACTTTCTTATCCAACTTTTTCATAGTAAGTGCGAAGACTGAGCCAGA
TTGGCCAATTAAAAACGAAAACCTGACTAGGTTCTGTAGAGCCAATTAGACTTGAAATAC
GTTTGTGTTTCTAGAATCACAGCTCAAGCATTCTGTTTATCGCTCACTCTCCCTTGTACA
GCCTTATTTTGTTGGTGCTTTGCATTTTGATATTGCTGTGAGCCTTGCATGACATCATGA
GGCCGGATGAAACTTCTCAGTCCAGCAGTTTCCAGTCCTAACAAATGCTCCCACCTGAAT
TTGTATATGACTGCATTTGTGTGTGTGTGTGTGTTTTCAGCAAATTCCAGATTTGTTTCC
TTTTGGCCTCCTGCAAAGTCTCCAGAAGAAAATTTGCCAATCTTTCCTACTTTCTATTTT
TATGATGACAATCAAAGCCGGCCTGAGAAACACTATTTGTGACTTTTTAAACGATTAGTG
ATGTCCTTAAAATGTGGTCTGCCAATCTGTACAAAATGGTCCTATTTTTGTGAAGAGGGA
CATAAGATAAAATGATGTTATACATCAATATGTATATATGTATTTCTATATAGACTTGGA
GAATACTGCCAAAACATTTATGACAAGCTGTATCACTGCCTTCGTTTATATTTTTTTAAC
TGTGATAATCCCCACAGGCACATTAACTGTTGCACTTTTGAATGTCCAAAATTTATATTT
TAGAAATAATAAAAAGAAAGATACTTACATGTTCCCAAAACAATGGTGTGGTGAATGTGT
GAGAAAAACTAACTTGATAGGGTCTACCAATACAAAATGTATTACGAATGCCCCTGTTCA
TGTTTTTGTTTTAAAACGTGTAAATGAAGATCTTTATATTTCAATAAATGATATATAATT
TAAAGTTA

Protein Sequence

>5156 : length: 1114
MLPRLVLNSWAQMICLPQLPKFPRAMGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNEN
EKVVQLNSSFSLRCFGESEVSWQYPMSEEESSDVEIRNEENNSGLFVTVLEVSSASAAHT
GLYTCYYNHTQTEENELEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDP
ETPVTLHNSEGVVPASYDSRQGFNGTFTVGPYICEATVKGKKFQTIPFNVYALKATSELD
LEMEALKTVYKSGETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTL
TVPEATVKDSGDYECAARQATREVKEMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHF
VVEVRAYPPPRISWLKNNLTLIENLTEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIV
AQNEDAVKSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKK
CNNETSWTILANNVSNIITEIHSRDRSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELK
LVAPTLRSELTVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYV
DPMQLPYDSRWEFPRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARS
SEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLS
HHPEKPKKELDIFGLNPADESTRSYVILSFENNGDYMDMKQADTTQYVPMLERKEVSKYS
DIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCV
HRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTL
SDVWSYGILLWEIFSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNS
EPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKN
EEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSS
SSTFIKREDETIEDIDMMDDIGIDSSDLVEDSFL