ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5155

Name

PDGFB

Synonym

IBGC5|PDGF-2|PDGF2|SIS|SSV|c-sis;platelet-derived growth factor beta polypeptide;PDGFB;platelet-derived growth factor beta polypeptide

Definition

PDGF subunit B|PDGF, B chain|becaplermin|platelet-derived growth factor 2|platelet-derived growth factor B chain|platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)|platelet-derived growth factor subunit B|plate

Position

22q13.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

transcriptional activation of dbpb from mrna;PID BioCarta;100190

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Hemostasis;Reactome;REACT:604

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

Angiogenesis;PANTHER;P00005

Pathway

PDGFR-beta signaling pathway;PID Curated;200127

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Disease

Cancers of the nervous system;KEGG DISEASE

Disease

Cancers;KEGG DISEASE

Disease

Giant-cell fibroblastoma;OMIM

Disease

Cancers of the lung and pleura;KEGG DISEASE

Disease

Systemic scleroderma;FunDO

Disease

Glioma;KEGG DISEASE;H00042

Disease

Bone marrow disease;FunDO

Disease

Cancer;FunDO

Disease

Meningioma, SIS-related;OMIM

Disease

Dermatofibrosarcoma protuberans;OMIM

Disease

Malignant pleural mesothelioma;KEGG DISEASE;H00015

Disease

Atherosclerosis;FunDO

External Links

Links to cell senescence gene database

5155

Links to epithelial mesenchymal transition gene database

5155

Links to ovarian cancer gene database

5155

Links to endometrial cancer gene database

5155

Links to iHOP

5155

Sequence Information

Nucleotide Sequence

>5155 : length: 3393
CCTGCCTGCCTCCCTGCGCACCCGCAGCCTCCCCCGCTGCCTCCCTAGGGCTCCCCTCCG
GCCGCCAGCGCCCATTTTTCATTCCCTAGATAGAGATACTTTGCGCGCACACACATACAT
ACGCGCGCAAAAAGGAAAAAAAAAAAAAAAAGCCCACCCTCCAGCCTCGCTGCAAAGAGA
AAACCGGAGCAGCCGCAGCTCGCAGCTCGCAGCTCGCAGCCCGCAGCCCGCAGAGGACGC
CCAGAGCGGCGAGCGGGCGGGCAGACGGACCGACGGACTCGCGCCGCGTCCACCTGTCGG
CCGGGCCCAGCCGAGCGCGCAGCGGGCACGCCGCGCGCGCGGAGCAGCCGTGCCCGCCGC
CCGGGCCCCGCGCCAGGGCGCACACGCTCCCGCCCCCCTACCCGGCCCGGGCGGGAGTTT
GCACCTCTCCCTGCCCGGGTGCTCGAGCTGCCGTTGCAAAGCCAACTTTGGAAAAAGTTT
TTTGGGGGAGACTTGGGCCTTGAGGTGCCCAGCTCCGCGCTTTCCGATTTTGGGGGCCTT
TCCAGAAAATGTTGCAAAAAAGCTAAGCCGGCGGGCAGAGGAAAACGCCTGTAGCCGGCG
AGTGAAGACGAACCATCGACTGCCGTGTTCCTTTTCCTCTTGGAGGTTGGAGTCCCCTGG
GCGCCCCCACACGGCTAGACGCCTCGGCTGGTTCGCGACGCAGCCCCCCGGCCGTGGATG
CTCACTCGGGCTCGGGATCCGCCCAGGTAGCGGCCTCGGACCCAGGTCCTGCGCCCAGGT
CCTCCCCTGCCCCCCAGCGACGGAGCCGGGGCCGGGGGCGGCGGCGCCCGGGGGCCATGC
GGGTGAGCCGCGGCTGCAGAGGCCTGAGCGCCTGATCGCCGCGGACCCGAGCCGAGCCCA
CCCCCCTCCCCAGCCCCCCACCCTGGCCGCGGGGGCGGCGCGCTCGATCTACGCGTCCGG
GGCCCCGCGGGGCCGGGCCCGGAGTCGGCATGAATCGCTGCTGGGCGCTCTTCCTGTCTC
TCTGCTGCTACCTGCGTCTGGTCAGCGCCGAGGGGGACCCCATTCCCGAGGAGCTTTATG
AGATGCTGAGTGACCACTCGATCCGCTCCTTTGATGATCTCCAACGCCTGCTGCACGGAG
ACCCCGGAGAGGAAGATGGGGCCGAGTTGGACCTGAACATGACCCGCTCCCACTCTGGAG
GCGAGCTGGAGAGCTTGGCTCGTGGAAGAAGGAGCCTGGGTTCCCTGACCATTGCTGAGC
CGGCCATGATCGCCGAGTGCAAGACGCGCACCGAGGTGTTCGAGATCTCCCGGCGCCTCA
TAGACCGCACCAACGCCAACTTCCTGGTGTGGCCGCCCTGTGTGGAGGTGCAGCGCTGCT
CCGGCTGCTGCAACAACCGCAACGTGCAGTGCCGCCCCACCCAGGTGCAGCTGCGACCTG
TCCAGGTGAGAAAGATCGAGATTGTGCGGAAGAAGCCAATCTTTAAGAAGGCCACGGTGA
CGCTGGAAGACCACCTGGCATGCAAGTGTGAGACAGTGGCAGCTGCACGGCCTGTGACCC
GAAGCCCGGGGGGTTCCCAGGAGCAGCGAGCCAAAACGCCCCAAACTCGGGTGACCATTC
GGACGGTGCGAGTCCGCCGGCCCCCCAAGGGCAAGCACCGGAAATTCAAGCACACGCATG
ACAAGACGGCACTGAAGGAGACCCTTGGAGCCTAGGGGCATCGGCAGGAGAGTGTGTGGG
CAGGGTTATTTAATATGGTATTTGCTGTATTGCCCCCATGGGGTCCTTGGAGTGATAATA
TTGTTTCCCTCGTCCGTCTGTCTCGATGCCTGATTCGGACGGCCAATGGTGCTTCCCCCA
CCCCTCCACGTGTCCGTCCACCCTTCCATCAGCGGGTCTCCTCCCAGCGGCCTCCGGCGT
CTTGCCCAGCAGCTCAAGAAGAAAAAGAAGGACTGAACTCCATCGCCATCTTCTTCCCTT
AACTCCAAGAACTTGGGATAAGAGTGTGAGAGAGACTGATGGGGTCGCTCTTTGGGGGAA
ACGGGCTCCTTCCCCTGCACCTGGCCTGGGCCACACCTGAGCGCTGTGGACTGTCCTGAG
GAGCCCTGAGGACCTCTCAGCATAGCCTGCCTGATCCCTGAACCCCTGGCCAGCTCTGAG
GGGAGGCACCTCCAGGCAGGCCAGGCTGCCTCGGACTCCATGGCTAAGACCACAGACGGG
CACACAGACTGGAGAAAACCCCTCCCACGGTGCCCAAACACCAGTCACCTCGTCTCCCTG
GTGCCTCTGTGCACAGTGGCTTCTTTTCGTTTTCGTTTTGAAGACGTGGACTCCTCTTGG
TGGGTGTGGCCAGCACACCAAGTGGCTGGGTGCCCTCTCAGGTGGGTTAGAGATGGAGTT
TGCTGTTGAGGTGGCTGTAGATGGTGACCTGGGTATCCCCTGCCTCCTGCCACCCCTTCC
TCCCCACACTCCACTCTGATTCACCTCTTCCTCTGGTTCCTTTCATCTCTCTACCTCCAC
CCTGCATTTTCCTCTTGTCCTGGCCCTTCAGTCTGCTCCACCAAGGGGCTCTTGAACCCC
TTATTAAGGCCCCAGATGATCCCAGTCACTCCTCTCTAGGGCAGAAGACTAGAGGCCAGG
GCAGCAAGGGACCTGCTCATCATATTCCAACCCAGCCACGACTGCCATGTAAGGTTGTGC
AGGGTGTGTACTGCACAAGGACATTGTATGCAGGGAGCACTGTTCACATCATAGATAAAG
CTGATTTGTATATTTATTATGACAATTTCTGGCAGATGTAGGTAAAGAGGAAAAGGATCC
TTTTCCTAATTCACACAAAGACTCCTTGTGGACTGGCTGTGCCCCTGATGCAGCCTGTGG
CTTGGAGTGGCCAAATAGGAGGGAGACTGTGGTAGGGGCAGGGAGGCAACACTGCTGTCC
ACATGACCTCCATTTCCCAAAGTCCTCTGCTCCAGCAACTGCCCTTCCAGGTGGGTGTGG
GACACCTGGGAGAAGGTCTCCAAGGGAGGGTGCAGCCCTCTTGCCCGCACCCCTCCCTGC
TTGCACACTTCCCCATCTTTGATCCTTCTGAGCTCCACCTCTGGTGGCTCCTCCTAGGAA
ACCAGCTCGTGGGCTGGGAATGGGGGAGAGAAGGGAAAAGATCCCCAAGACCCCCTGGGG
TGGGATCTGAGCTCCCACCTCCCTTCCCACCTACTGCACTTTCCCCCTTCCCGCCTTCCA
AAACCTGCTTCCTTCAGTTTGTAAAGTCGGTGATTATATTTTTGGGGGCTTTCCTTTTAT
TTTTTAAATGTAAAATTTATTTATATTCCGTATTTAAAGTTGTAAAAAAAAATAACCACA
AAACAAAACCAAATGAAAAAAAAAAAAAAAAAA

Protein Sequence

>5155 : length: 241
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A