ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5154

Name

PDGFA

Synonym

PDGF-A|PDGF1;platelet-derived growth factor alpha polypeptide;PDGFA;platelet-derived growth factor alpha polypeptide

Definition

PDGF A-chain|PDGF subunit A|PDGF-1|platelet-derived growth factor A chain|platelet-derived growth factor alpha chain|platelet-derived growth factor alpha isoform 2 preproprotein|platelet-derived growth factor subunit A

Position

7p22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

role of pi3k subunit p85 in regulation of actin organization and cell migration;PID BioCarta;100211

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

pdgf signaling pathway;PID BioCarta;100077

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Ceramide signaling pathway;PID Curated;200100

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

phospholipids as signalling intermediaries;PID BioCarta;100183

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Disease

Cancers of the nervous system;KEGG DISEASE

Disease

Cancers;KEGG DISEASE

Disease

Cancers of the lung and pleura;KEGG DISEASE

Disease

Glioma;KEGG DISEASE;H00042

Disease

Cancer;FunDO

Disease

Endometriosis;FunDO

Disease

Malignant pleural mesothelioma;KEGG DISEASE;H00015

External Links

Links to cell senescence gene database

5154

Links to epithelial mesenchymal transition gene database

5154

Links to ovarian cancer gene database

5154

Links to endometrial cancer gene database

5154

Links to iHOP

5154

Sequence Information

Nucleotide Sequence

>5154 : length: 2809
ACGCGCGCCCTGCGGAGCCCGCCCAACTCCGGCGAGCCGGGCCTGCGCCTACTCCTCCTC
CTCCTCTCCCGGCGGCGGCTGCGGCGGAGGCGCCGACTCGGCCTTGCGCCCGCCCTCAGG
CCCGCGCGGGCGGCGCAGCGAGGCCCCGGGCGGCGGGTGGTGGCTGCCAGGCGGCTCGGC
CGCGGGCGCTGCCCGGCCCCGGCGAGCGGAGGGCGGAGCGCGGCGCCGGAGCCGAGGGCG
CGCCGCGGAGGGGGTGCTGGGCCGCGCTGTGCCCGGCCGGGCGGCGGCTGCAAGAGGAGG
CCGGAGGCGAGCGCGGGGCCGGCGGTGGGCGCGCAGGGCGGCTCGCAGCTCGCAGCCGGG
GCCGGGCCAGGCGTCCAGGCAGGTGATCGGTGTGGCGGCGGCGGCGGCGGCGGCCCCAGA
CTCCCTCCGGAGTTCTTCTTGGGGCTGATGTCCGCAAATATGCAGAATTACCGGCCGGGT
CGCTCCTGAAGCCAGCGCGGGGAGCGAGCGCGGCGGCGGCCAGCACCGGGAACGCACCGA
GGAAGAAGCCCAGCCCCCGCCCTCCGCCCCTTCCGTCCCCACCCCCTACCCGGCGGCCCA
GGAGGCTCCCCGCGCTGCGGGCGCGCACTCCCTGTTTCTCCTCCTCCTGGCTGGCGCTGC
CTGCCTCTCCGCACTCACTGCTCGCGCCGGGCGCGCTCCGCCAGCTCCGTGCTCCCCGCG
CCACCCTCCTCCGGGCCGCGCTCCCTAAGGGATGGTACTGAATTTCGCCGCCACAGGAGA
CCGGCTGGAGCGCCCGCCCCGCGGCCTCGCCTCTCCTCCGAGCAGCCAGCGCCTCGGGAC
GCGATGAGGACCTTGGCTTGCCTGCTGCTCCTCGGCTGCGGATACCTCGCCCATGTTCTG
GCCGAGGAAGCCGAGATCCCCCGCGAGGTGATCGAGAGGCTGGCCCGCAGTCAGATCCAC
AGCATCCGGGACCTCCAGCGACTCCTGGAGATAGACTCCGTAGGGAGTGAGGATTCTTTG
GACACCAGCCTGAGAGCTCACGGGGTCCATGCCACTAAGCATGTGCCCGAGAAGCGGCCC
CTGCCCATTCGGAGGAAGAGAAGCATCGAGGAAGCTGTCCCCGCTGTCTGCAAGACCAGG
ACGGTCATTTACGAGATTCCTCGGAGTCAGGTCGACCCCACGTCCGCCAACTTCCTGATC
TGGCCCCCGTGCGTGGAGGTGAAACGCTGCACCGGCTGCTGCAACACGAGCAGTGTCAAG
TGCCAGCCCTCCCGCGTCCACCACCGCAGCGTCAAGGTGGCCAAGGTGGAATACGTCAGG
AAGAAGCCAAAATTAAAAGAAGTCCAGGTGAGGTTAGAGGAGCATTTGGAGTGCGCCTGC
GCGACCACAAGCCTGAATCCGGATTATCGGGAAGAGGACACGGGAAGGCCTAGGGAGTCA
GGTAAAAAACGGAAAAGAAAAAGGTTAAAACCCACCTAAAGCAGCCAACCAGATGTGAGG
TGAGGATGAGCCGCAGCCCTTTCCTGGGACATGGATGTACATGGCGTGTTACATTCCTGA
ACCTACTATGTACGGTGCTTTATTGCCAGTGTGCGGTCTTTGTTCTCCTCCGTGAAAAAC
TGTGTCCGAGAACACTCGGGAGAACAAAGAGACAGTGCACATTTGTTTAATGTGACATCA
AAGCAAGTATTGTAGCACTCGGTGAAGCAGTAAGAAGCTTCCTTGTCAAAAAGAGAGAGA
GAGAAAGAGAGAGAGAAAACAAAACCACAAATGACAAAAACAAAACGGACTCACAAAAAT
ATCTAAACTCGATGAGATGGAGGGTCGCCCCGTGGGATGGAAGTGCAGAGGTCTCAGCAG
ACTGGATTTCTGTCCGGGTGGTCACAGGTGCTTTTTTGCCGAGGATGCAGAGCCTGCTTT
GGGAACGACTCCAGAGGGGTGCTGGTGGGCTCTGCAGGGGCCCGCAGGAAGCAGGAATGT
CTTGGAAACCGCCACGCGAACTTTAGAAACCACACCTCCTCGCTGTAGTATTTAAGCCCA
TACAGAAACCTTCCTGAGAGCCTTAAGTGGTTTTTTTTTTTGTTTTTGTTTTGTTTTTTT
TTTTTTTGTTTTTTTTTTTTTTTTTTTACACCATAAAGTGATTATTAAGCTTTCCTTTTT
ACTCTTTGGCTAGCTTTTTTTTTTTTTTTTTTTTTTTAATTATCTCTTGGATGACATTTA
CACCGATAACACACAGGCTGCTGTAACTGTCAGGACAGTGCGACGGTATTTTTCCTAGCA
AGATGCAAACTAATGAGATGTATTAAAATAAACATGGTATACCTACCTATGCATCATTTC
CTAAATGTTTCTGGCTTTGTGTTTCTCCCTTACCCTGCTTTATTTGTTAATTTAAGCCAT
TTTGAAAGAACTATGCGTCAACCAATCGTACGCCGTCCCTGCGGCACCTGCCCCAGAGCC
CGTTTGTGGCTGAGTGACAACTTGTTCCCCGCAGTGCACACCTAGAATGCTGTGTTCCCA
CGCGGCACGTGAGATGCATTGCCGCTTCTGTCTGTGTTGTTGGTGTGCCCTGGTGCCGTG
GTGGCGGTCACTCCCTCTGCTGCCAGTGTTTGGACAGAACCCAAATTCTTTATTTTTGGT
AAGATATTGTGCTTTACCTGTATTAACAGAAATGTGTGTGTGTGGTTTGTTTTTTTGTAA
AGGTGAAGTTTGTATGTTTACCTAATATTACCTGTTTTGTATACCTGAGAGCCTGCTATG
TTCTTTTTTTGTTGATCCAAAATTAAAAAAAAAAATACCACCAACAAAA

Protein Sequence

>5154 : length: 256
MWVEGPHSDAPGLGSWAGARGSRQETGWSARPAASPLLRAASASGRDEDLGLPAAPRLRI
PRPCSGRGSRDPPRGDREAGPQSDPQHPGPPATPGDRLRSEDSLDTSLRAHGVHATKHVP
EKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNT
SSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGR
PRESGKKRKRKRLKPT