ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

51341

Name

ZBTB7A

Synonym

FBI-1|FBI1|LRF|ZBTB7|ZNF857A|pokemon;zinc finger and BTB domain containing 7A;ZBTB7A;zinc finger and BTB domain containing 7A

Definition

HIV-1 1st-binding protein 1|HIV-1 inducer of short transcripts binding protein|POK erythroid myeloid ontogenic factor|POZ and Krueppel erythroid myeloid ontogenic factor|TIP21|TTF-I-interacting peptide 21|factor binding IST protein 1|factor that binds to

Position

19p13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

b cell survival pathway;PID BioCarta;100228

External Links

Links to cell senescence gene database

51341

Links to epithelial mesenchymal transition gene database

51341

Links to ovarian cancer gene database

51341

Links to endometrial cancer gene database

51341

Links to iHOP

51341

Sequence Information

Nucleotide Sequence

>51341 : length: 6906
GCGCACGGTGGGCCGCGGCGGGAGGTTGCTGTCCACCCGGGCCCGGACACCCAGTCGGCG
CCCACTAAATGTTGGCGGAATGCAGCCAGGAGTTGGCGGCGAGGCGGGGGGAGGCAGCAA
CTCCTCTCCCCCCAGTCAGGCGGCGGAAGTCACAGAGGTGCTGGTGCCCCTGCCACCCGC
GGCACCCACCTGGCTCACCCATGGGTGGCGGGCTCGGTGGGCCCCCCCACCTCCCTGCCA
GCTGCCTCCGGAGAGGGCGTGGGGATTCCGTGTCAGTGCCCCCCGCCCCAACCTCAGAAC
TGGACCAGGGCGTAACCCTGAGCGTGCCGCTCCCACACTGGGGGTGCCTCCCCACCACCG
GCCGATCACTTCCTATTGGCAAACTGGTCTGGGAGAGGTCCCGGGGAGGCCAGGCTGGGG
CAGGGGCCCAGGCCAGGCCAGGCCTAAGCCCAGCCCTGCTGCTGCCAGGGCCTGAGGGCT
TCAGGCCGGGGGCGTTTGTCCGCGAGGGCCACCCGCCATGGGGCCCCGAGAGCACCTATC
GGCGGGGCCGGGGCCTCTGTTTACCACCAGCCATCGCTGTGGAGACAGAGCTTGGGGGAG
AAGGGGGGGCAGGAGCCGGCCGCTGGAAAAGCGAAGTCTAAGGAAGGAAAGAAGAGCCAA
CCGGGACACTGAAATTTTAATTCGTGGGTCTCGGCGCGGAAGATGGCCGGCGGCGTGGAC
GGCCCCATCGGGATCCCGTTCCCCGACCACAGCAGCGACATCCTGAGTGGGCTGAACGAG
CAGCGGACGCAGGGCCTGCTGTGCGACGTGGTGATCCTGGTGGAGGGCCGCGAGTTCCCC
ACGCACCGCTCGGTGCTGGCCGCCTGCAGCCAGTACTTCAAGAAGCTGTTCACGTCGGGC
GCCGTGGTGGACCAGCAGAACGTGTACGAGATCGACTTCGTCAGCGCCGAGGCGCTCACC
GCGCTCATGGACTTCGCCTACACGGCCACGCTCACCGTCAGCACAGCCAACGTGGGTGAC
ATCCTCAGCGCCGCCCGCCTGCTGGAGATCCCCGCCGTGAGCCACGTGTGCGCCGACCTC
CTGGACCGGCAGATCCTGGCGGCCGACGCGGGCGCCGACGCCGGGCAGCTGGACCTTGTA
GATCAAATTGATCAGCGCAACCTCCTCCGCGCCAAGGAGTACCTCGAGTTCTTCCAGAGC
AACCCCATGAACAGCCTGCCCCCCGCGGCCGCCGCCGCCGCTGCCAGCTTCCCGTGGTCC
GCCTTTGGGGCGTCCGATGATGACCTGGATGCCACCAAGGAGGCCGTGGCCGCCGCTGTG
GCCGCCGTGGCCGCGGGCGACTGCAACGGCTTAGACTTCTATGGGCCGGGCCCCCCGGCC
GAGCGGCCCCCGACGGGGGACGGGGACGAGGGCGACAGCAACCCGGGTCTGTGGCCAGAG
CGGGATGAGGACGCCCCCACCGGGGGTCTCTTTCCGCCGCCGGTGGCCCCGCCGGCCGCC
ACGCAGAACGGCCACTACGGCCGCGGCGGAGAGGAGGAGGCCGCCTCGCTGTCGGAGGCG
GCCCCCGAGCCGGGCGACTCTCCGGGCTTCCTGTCGGGAGCGGCCGAGGGCGAGGACGGG
GACGGGCCCGACGTGGACGGGCTGGCGGCCAGCACGCTGCTGCAGCAGATGATGTCATCG
GTGGGCCGGGCGGGGGCCGCGGCGGGGGACAGCGACGAGGAGTCGCGGGCCGACGACAAG
GGCGTCATGGACTACTACCTGAAGTACTTCAGCGGCGCCCACGACGGCGACGTCTACCCG
GCCTGGTCGCAGAAGGTGGAGAAGAAGATCCGAGCCAAGGCCTTCCAGAAGTGCCCCATC
TGCGAGAAGGTCATCCAGGGCGCCGGCAAGCTGCCGCGACACATCCGCACCCACACGGGC
GAGAAGCCCTACGAGTGCAACATCTGCAAGGTCCGCTTCACCAGGCAGGACAAGCTGAAG
GTGCACATGCGGAAGCACACGGGCGAGAAGCCGTACCTGTGCCAGCAGTGCGGCGCCGCC
TTTGCCCACAACTACGACCTGAAGAACCACATGCGCGTGCACACGGGCCTGCGCCCCTAC
CAGTGCGACAGCTGCTGCAAGACCTTCGTCCGCTCCGACCACCTGCACAGACACCTCAAG
AAAGACGGCTGCAACGGCGTCCCCTCGCGCCGCGGCCGCAAGCCCCGCGTCCGGGGCGGG
GCGCCCGACCCCAGCCCGGGGGCCACCGCGACCCCCGGCGCCCCCGCCCAGCCCAGCTCC
CCCGACGCCCGGCGCAACGGCCAGGAGAAGCACTTTAAGGACGAGGACGAGGACGAGGAC
GTGGCCAGCCCCGACGGCTTGGGCCGGTTGAATGTAGCGGGCGCCGGTGGAGGAGGTGAC
AGCGGAGGTGGCCCCGGGGCCGCCACCGACGGTAACTTCACAGCCGGACTCGCCTAAAAA
CCAAAAAGAGAAAACAGAAACCCGAGAAAGAGAGAGACAGAGAGAGAGAAAAAAAATCAC
CCACCACCCCCCCAAAAACACAAAAAAAGAAAATCTATCTATATACAGATATCTATATCT
ATATATATATATACAGATATATATATATGACGCGTCACAGAATCTAGGGTAGCGCTTTCT
CAGATTTCCCTCCTTTCTGACGTTTTTCTCCCTCCGCAGGGGCCCCGGCCCTCCCTGGCT
CCCCTTCCCCCCACCACCCCATCGCTGGGTTTCGGGGCTTGGTTTGGGGTTTTTTGTAGG
ACACAAGGAATCCGAGACCCCGCACAGCCCCCTGGGCACCCGGCATGGGGCCTGGGGCCC
GATCCGAGGCCCTGGGCTGGGGGGAGGGTAGACGTGGGGGCGCTGGGGGGGGACTGGGGT
GGGCTTTTAATTTCCTCCCCTCGCTGGTTTCTATGAGTCTTTCAGACAAGACCTTAAATG
ATTTCTGTCTGCTCTGAGCGGACGTTAAAATGGGCCCCCGTCCCCCGACCCGCACCCTCC
TTCCTCAGGGCACTTACTAAGGGAGGGGTCTCCCTCTCCATCTCCCCAGTGGCCTCCCCG
CCTCCAACCCTGCCTGCGGCCTCCCCCCGTCGCCCACCCCACGTCTCCTGGCCACTGAGA
CACAAACCTATTTATTTCTAGGCCTGGAGAAAGGAGATCGGACTGGGGTTCCCGGTGGGG
CGCCAGGATGGCTCCTGGGGGTGCTCCTGCCGCCTTCCTTCACGGCACTTACAACCGGCG
GGACCCCCAGGGACCACCCCTCAGGGCGCCCCCCCACCCCCGCCCGGTCCACCTAGACCC
CCACGTTTGGAGATTCAAAACTTCTGTCTTCGTCCTCTCCCCCGAGCCCCCTCTCCCAAA
TTTTTAAAGCACTTTTTAGATTTTTTTTTCTCTTTCCTCCTTAAAAACAAAATTTATATA
TAGATATATATATATATATAAATAATATACTTTTCCTCAGAGGAGCAGGCAACAGTGTGG
GATAAACAGAGTCACGATCAGAGGAACCCCAGGGTCTGGTGATGGCAGGGATGGGGGGAG
AGAGAGAAAATCCACAAATTCCAATGTCACAAAAGCAATAAAACAAACTAGAAAAAAAAA
AGGTTTTACAAAATGAAAGGAAGGAAAAAAAAAAAGGCAACCAACCACATTAGAAGTCTT
GGCACTTTGTAACGGAACGGGTACTACACTTTATCTTAATTCTTAATTTAAAAACATGTT
TACAAGTTACAACCAACTTCTATGAAAAGTTGAAAAGACAAAAAAAAAAAAAAAAAGCGA
GCGAGAGAGAGAGCGAGAGAGAGAGCGAGAGCAGAAGAAATTCCTAAAAGTCGATTTATT
TTTGTACAAAATAATAAAAAAAAAAACCCACCACAAACGTAGAATCCACTTCTGTTCCCC
AAAAAGCGAGAAGGGGGGTTCAGGAGGAAGCCATCGCAGGGGACCTGGGAGACGCCCCGA
GGTGTTTGTGCTTCACCCCCAGACGTCAGCCTCGAAGGCAGGACTGTGGGGTGTTCGTGC
TGTGTTCCCCCCGCTCCCCCTTTCTGTCCCCTTTTTTGGTTCTGACGTGAAGAGGTCTTA
GCGCCCGCTTCTGTCCACGGGGTCTCTCCTTCCTCCTCCCTAGCTCAGGGATGGGCCTTC
CAGCCGGAGCACCCCGATCCCCATCCGGCACCCCCCAATCCCCCAACACGCCTGTCCCTC
CCGCATGGCCACCAAGGAGCTGGACCTTGGATGCGCCTACCCTGCTGAGGTGGGTGACAG
GGGCCCCCCACCTCCAGGGCCTTAGAACCACCGCCCCTCTCCCCACCCCAGGCACCCCTC
TTTTTACTCAAAGGCACTGACTGTAATCCAGGGGGACTGGGACCTGCCTCCCCCCAACCT
CTGGCTCCCACAAGGCCCGGTGTTGACCGAGCCACAGGCCACGGACAGGGGCCGGGGTTG
GGGAGACTATGTCGCCAGATGCCAGGACGCCCTCACCCCGTTTGCATATGCAATGCTAGC
ATGGGACCCCGAAAATAGACGCTCTGCTGCACTGAGACTTCTTGTCAATGCCCAACCGGC
GGGGGGGTGTCTCCCTGCCCCCGACCCCCCCATACCCCCTTCTCTGTGACACACACATCT
TCTCGTCTCTTTTTCTTTCATTGTTAAAGGGAAGCTTTTTAAGAAGGCAATTTTCATATT
GTTTCTACAGGATGGTTTTGGTTCCCTTCCCTTCCCACCCCCCCTTAAGCCTGTCAGCCC
CCTCCAAATGTCTCAGGATCCCCCCTCTCCCCTGGGGCTGGGTGACAGCACCCCGGCTGC
GTTCACACCCCAGTGTCACAGGGCGAGCTGTTCTGGAGAGAAAACCATCTGTCGTGGCTG
AGCGGGGAGCTTGAACACCCAGGCCAGGGACACCCCTCCCCAGCTCCCAGAGAGGCCCCC
TGAGGGGTGAGCCCTCTTTCCACCTTCCCCTATCCATGCACCCCCTCGCAATAAAACCAA
CTCTAAAATCACAGCTGTCGTCCTAGCCAGTGGGGGCGACCGGACTTGGGGGGTGGAGCC
CTCTGGGACTTCCGTAGGAACAAGGGCTGCGGCCCACCGCGACACTTACACAGACCTCGG
GGATTGCACTAAACCCTCGTTCCTAGCTCCGCACTCAGCTTCGCCTGTCCTGCCCGCCCA
CTTTGCCTTAACTACCCGCCCGTCCTGGGGGCCACAGCCTCTGCATGGGCCCAGAGCCGG
GACCCCCCCAGCCCAGCCCCGCCCTCCCCAGACTCCGCGCAATCACATACTGTATATAGA
CGTGAATCGATTTTATTTTTATTCTTTAAATTAAGGTCGTGATAAAGTGTTGCCAAAGAT
ACCTGCTGAATTCTCGCGTTTCAGGAAACAAACAAACAAAAAAAAATGATATTTGAGGAG
GGTCGTGTTGACTCCATATGAAAGGACACAGCTCAAAGCTTTTTTGTTTGGTTGTTTGGG
GTTTTTTGTGTTTTCTTTTTTTGGGGTGTTTTTTTTTTAACTGCCTGGTACAAAAAAAAA
AAGAGAAAAAAAAAAAAGAAAAACAATGCGAAATTGTTATTTCCATTCTCATGGTGAAGT
TGCGTGGACGCGTGTGTGCGTGTGTGCAAGAGAGCGGGAGTGAGGTCCAGGCTGGGGTTG
GGGGGCTTCAGGCGGGGGCGCCCGGGGGCCGGGGAGGTGGCCGGGCCGGAGCCCCCGTCT
GCAGTGCCCCCCAGCCTGCCGGGCCCAGGAGAGAGAGAGAAGCATCTTTGCTACTAGCTG
TTGCTGCTACCTGCCTCTGCCCCCCGACGCCCCCCGCCTTTTGAGATTAAGGAAAAAAAA
AAAAAGTCAAAAAAGTTTTTAAAAATGAAAAAAAAAAATTATAAACCAGTGAATGTAAAA
TGCCGGAGCAGGCCCGGCCTGGCATGGGTGTGGACCTGCAGCCAGGCAGGCTCGAGCGGG
CGATACCAAAGTCTGCCCCCCCACCATTGTGGCCATGCAGTCCTGTCACTGTCTTTTTGC
TTCCTTCCGAGGGGGGTCCCCCAGCCTCTTCCAGGGTCTTCCCCTGGAAGTGGGCGGCTG
CAGGGAAGGTGGGGGACAGGGGTCTTTGCACGATTCAGACCCCGGGGCCGTGGCAGGAGC
GGTCACCTCACAGGTGGTGACACTGAGGCAGGGGCCTCGGGGTGCCCCCTCCCGCCCGGC
AACCAGAATGGTTGGAGGCAAGACAGAGAGAATGAAAGGAAAAACAGAAGAAAAAAAAAT
ATTAAAAACCAACAAAAAAAGCAAAAATCCTATTTTTTGAGAAAGAAAGATATTTATATT
TGCAGTTTTATTTTAAAAAGTTATTTAAGTTGAAGCAGCCTTCCTGGAGGTGGGGGGGGG
GGGGTGGTGGGTGGCTGGCGCAGGACGGGTCAGGGGCCTGGAGGCTGGGGGTGCCCCAGG
AGCTACAACCTCAGAGTTAAGACTAGCTCGCATTAAATACATAGATTTACGGGGGGGGGG
GGGGGGGGCCGGGCCCAGGGGGTGGAGGGGGCCAGGGAGACCCCCATCCCTCGCCGGGGC
TGCCTGGAGGCTGTGGACCAGGATCCGATGCCCAGGTCCCGCCCCCCACCCCACCCCAGG
CCCAGAATCGAGGTGCCTTGGACTTTGGAGGGGCCAGGCCTGGTGAATGGGGGGCGGGGC
GGCGCCCTCAGGGTACAGAGCACAGACAGATAGACATTCCAGAGACTGTATTGAGAGTCT
TTATAAAGTGTGGGAGATTTAAAAAAAAAAAAAACTGATAAAAATGCACTTTTTGGGAGT
GGGGAGGGAGAAGCTTTAAAAGTAATAAAAAACAAACAAAAACACAAAAGATGAAAAAAC
AAAAAAATTCATTTTTCTTGTACATAAAAAAAAAAAAAGAACCACTAAACGCAGCCTGTT
ACGACC

Protein Sequence

>51341 : length: 584
MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFK
KLFTSGAVVDQQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVS
HVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSNPMNSLPPAAAAAA
ASFPWSAFGASDDDLDATKEAVAAAVAAVAAGDCNGLDFYGPGPPAERPPTGDGDEGDSN
PGLWPERDEDAPTGGLFPPPVAPPAATQNGHYGRGGEEEAASLSEAAPEPGDSPGFLSGA
AEGEDGDGPDVDGLAASTLLQQMMSSVGRAGAAAGDSDEESRADDKGVMDYYLKYFSGAH
DGDVYPAWSQKVEKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFT
RQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDH
LHRHLKKDGCNGVPSRRGRKPRVRGGAPDPSPGATATPGAPAQPSSPDARRNGQEKHFKD
EDEDEDVASPDGLGRLNVAGAGGGGDSGGGPGAATDGNFTAGLA