ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

51256

Name

TBC1D7

Synonym

MGCPH|PIG51|TBC7;TBC1 domain family, member 7;TBC1D7;TBC1 domain family, member 7

Definition

TBC1 domain family member 7|cell migration-inducing protein 23

Position

6p24.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

51256

Links to epithelial mesenchymal transition gene database

51256

Links to ovarian cancer gene database

51256

Links to endometrial cancer gene database

51256

Links to iHOP

51256

Sequence Information

Nucleotide Sequence

>51256 : length: 1340
GCATGCGCCCGCCCGGCGCCCGCCCGGCGACCTGGAGTTGATGTCACGTCCGGCGGCGGC
GGCAGCGGCAGCGGCAGCGGCGCTGAGTTTTGTCTCCCGGGCCGTCTGGGCGCGCGCGGG
TGTCCCAGGTACCCCGCCGCCTCCCTCCTTCCCGCAGGACTCGTCCCTCCTGGCCCTGGG
CCCCAACGGTGCCCGCCTGCCCGGCGGTCGGTCAGCGCACAGGGCACGGCTTCCTCTGCT
TCTCCCGGACCACTTAGTCTCAACCCGGGTGTGTTTGCACTACTAGAGAATGAAATATGA
CTGAGGACTCTCAGAGAAACTTTCGTTCAGTATATTATGAGAAAGTGGGGTTTCGTGGAG
TTGAAGAAAAGAAATCATTAGAAATTCTCCTAAAAGATGACCGTCTGGATACTGAGAAAC
TTTGTACTTTTAGTCAGAGGTTCCCTCTCCCGTCCATGTACCGTGCATTGGTATGGAAGG
TGCTTCTAGGAATCTTGCCTCCACACCACGAGTCCCATGCCAAGGTGATGATGTATCGTA
AGGAGCAGTACTTGGATGTCCTTCATGCCCTGAAAGTCGTTCGCTTTGTTAGTGATGCCA
CACCTCAGGCTGAAGTCTATCTCCGCATGTATCAGCTGGAGTCTGGGAAGTTACCTCGAA
GTCCCTCTTTTCCACTGGAGCCAGATGATGAAGTGTTTCTTGCCATAGCTAAAGCCATGG
AGGAAATGGTGGAAGATAGTGTCGACTGTTACTGGATCACCCGACGCTTTGTGAACCAAT
TAAATACCAAGTACCGGGATTCCTTGCCCCAGTTGCCAAAAGCGTTTGAACAATACTTGA
ATCTGGAAGATGGCAGACTGCTGACTCATCTGAGGATGTGTTCCGCGGCGCCCAAACTTC
CTTATGATCTCTGGTTCAAGAGGTGCTTTGCGGGATGTTTGCCTGAATCCAGTTTACAGA
GGGTTTGGGATAAAGTTGTGAGTGGATCCTGTAAGATCCTAGTTTTTGTAGCTGTCGAAA
TTTTATTAACCTTTAAAATAAAAGTTATGGCACTGAACAGTGCAGAGAAGATAACAAAGT
TTCTGGAAAATATTCCCCAGGACAGCTCAGACGCGATCGTGAGCAAGGCCATTGACTTGT
GGCACAAACACTGTGGGACCCCGGTCCATTCAAGCTGAACGCACCCGCTGGTTGTGGACC
GTCTGCCAGGCACCACAGTGAGCATTGTGTTCTTGGCATGTGATCTGGGAAACTGATTGA
ATAATACACTTTTCTTGCTTTGGTGCTCAAAGTGGTTTTTTTCCCCCAATAAAATTATTT
AATTGAAAAAAAAAAAAAAA

Protein Sequence

>51256 : length: 293
MTEDSQRNFRSVYYEKVGFRGVEEKKSLEILLKDDRLDTEKLCTFSQRFPLPSMYRALVW
KVLLGILPPHHESHAKVMMYRKEQYLDVLHALKVVRFVSDATPQAEVYLRMYQLESGKLP
RSPSFPLEPDDEVFLAIAKAMEEMVEDSVDCYWITRRFVNQLNTKYRDSLPQLPKAFEQY
LNLEDGRLLTHLRMCSAAPKLPYDLWFKRCFAGCLPESSLQRVWDKVVSGSCKILVFVAV
EILLTFKIKVMALNSAEKITKFLENIPQDSSDAIVSKAIDLWHKHCGTPVHSS