ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

51176

Name

LEF1

Synonym

LEF-1|TCF10|TCF1ALPHA|TCF7L3;lymphoid enhancer-binding factor 1;LEF1;lymphoid enhancer-binding factor 1

Definition

T cell-specific transcription factor 1-alpha|TCF1-alpha

Position

4q23-q25

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Arrhythmogenic right ventricular cardiomyopathy (ARVC);KEGG PATHWAY;hsa05412

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

multi-step regulation of transcription by pitx2;PID BioCarta;100074

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

Basal cell carcinoma;KEGG PATHWAY;hsa05217

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

other metabolic traits;GAD

Disease

Sebaceous tumors, somatic;OMIM

Disease

METABOLIC;GAD

Disease

Other metabolic traits;NHGRI

External Links

Links to cell senescence gene database

51176

Links to epithelial mesenchymal transition gene database

51176

Links to ovarian cancer gene database

51176

Links to endometrial cancer gene database

51176

Links to iHOP

51176

Sequence Information

Nucleotide Sequence

>51176 : length: 3620
AGCGCCGGCGAGGCGCGGGAGGAGGAGAAGCAGTGGGGAGGCGCAGCCGCTCACCTGCGG
GGCAGGGCGCGGAGGAGGGACCCGGGCTGCGCGCTCTCGGGCCGAGGAACCAGGACGCGC
CCGGAGCCTCGCACGCGGCCAAGCTCGGGGCGTCCCCTCCCCTCGGCCGGGCGAACTCAA
GGGGCGCAGCTCTTTGCTTTGACAGAGCTGGCCGGCGGAGGCGTGCAGAGCGGCGAGCCG
GCGAGCCAGGCTGAGAAACTCGAGCCGGGAACAAAGAGGGGTCGGACTGAGTGTGTGTGT
CGGCTCGAGCTCCGGGCAGAGGCATTTGGGCCCGAGGCCCCCGCTGTGACTCCCCGAGAC
TCCGCAGTGCCCTCCACTGCGGAGTCCCCGCGCTTGCCGGCAAAAACTTTATTCTTGGCA
AACTTCTCTTTCTCTTCCCCTCCTCCTCGGCCCCCATCTTCTGCTCCTCCTCCTTCTCTA
GCAGATTAAATGAGCCTCGAGAAGAAAAACCGAAGCGAAAGGGAAGAAAATAAGAAGATC
TAAAACGGACATCTCCAGCGTGGGTGGCTCCTTTTTCTTTTTCTTTTTTTCCCACCCTTC
AGGAAGTGGACGTTTCGTTATCTTCTGATCCTTGCACCTTCTTTTGGGGCAAACGGGGCC
CTTCTGCCCAGATCCCCTCTCTTTTCTCGGAAAACAAACTACTAAGTCGGCATCCGGGGT
AACTACAGTGGAGAGGGTTTCCGCGGAGACGCGCCGCCGGACCCTCCTCTGCACTTTGGG
GAGGCGTGCTCCCTCCAGAACCGGCGTTCTCCGCGCGCAAATCCCGGCGACGCGGGGTCG
CGGGGTGGCCGCCGGGGCAGCCTCGTCTAGCGCGCGCCGCGCAGACGCCCCCGGAGTCGC
CAGCTACCGCAGCCCTCGCCGCCCAGTGCCCTTCGGCCTCGGGGGCGGGCGCCTGCGTCG
GTCTCCGCGAAGCGGGAAAGCGCGGCGGCCGCCGGGATTCGGGCGCCGCGGCAGCTGCTC
CGGCTGCCGGCCGGCGGCCCCGCGCTCGCCCGCCCCGCTTCCGCCCGCTGTCCTGCTGCA
CGAACCCTTCCAACTCTCCTTTCCTCCCCCACCCTTGAGTTACCCCTCTGTCTTTCCTGC
TGTTGCGCGGGTGCTCCCACAGCGGAGCGGAGATTACAGAGCCGCCGGGATGCCCCAACT
CTCCGGAGGAGGTGGCGGCGGCGGGGGGGACCCGGAACTCTGCGCCACGGACGAGATGAT
CCCCTTCAAGGACGAGGGCGATCCTCAGAAGGAAAAGATCTTCGCCGAGATCAGTCATCC
CGAAGAGGAAGGCGATTTAGCTGACATCAAGTCTTCCTTGGTGAACGAGTCTGAAATCAT
CCCGGCCAGCAACGGACACGAGGTGGCCAGACAAGCACAAACCTCTCAGGAGCCCTACCA
CGACAAGGCCAGAGAACACCCCGATGACGGAAAGCATCCAGATGGAGGCCTCTACAACAA
GGGACCCTCCTACTCGAGTTATTCCGGGTACATAATGATGCCAAATATGAATAACGACCC
ATACATGTCAAATGGATCTCTTTCTCCACCCATCCCGAGAACATCAAATAAAGTGCCCGT
GGTGCAGCCATCCCATGCGGTCCATCCTCTCACCCCCCTCATCACTTACAGTGACGAGCA
CTTTTCTCCAGGATCACACCCGTCACACATCCCATCAGATGTCAACTCCAAACAAGGCAT
GTCCAGACATCCTCCAGCTCCTGATATCCCTACTTTTTATCCCTTGTCTCCGGGTGGTGT
TGGACAGATCACCCCACCTCTTGGCTGGCAAGGTCAGCCTGTATATCCCATCACGGGTGG
ATTCAGGCAACCCTACCCATCCTCACTGTCAGTCGACACTTCCATGTCCAGGTTTTCCCA
TCATATGATTCCCGGTCCTCCTGGTCCCCACACAACTGGCATCCCTCATCCAGCTATTGT
AACACCTCAGGTCAAACAGGAACATCCCCACACTGACAGTGACCTAATGCACGTGAAGCC
TCAGCATGAACAGAGAAAGGAGCAGGAGCCAAAAAGACCTCACATTAAGAAGCCTCTGAA
TGCTTTTATGTTATACATGAAAGAAATGAGAGCGAATGTCGTTGCTGAGTGTACTCTAAA
AGAAAGTGCAGCTATCAACCAGATTCTTGGCAGAAGGTGGCATGCCCTCTCCCGTGAAGA
GCAGGCTAAATATTATGAATTAGCACGGAAAGAAAGACAGCTACATATGCAGCTTTATCC
AGGCTGGTCTGCAAGAGACAATTATGGTAAGAAAAAGAAGAGGAAGAGAGAGAAACTACA
GGAATCTGCATCAGGTACAGGTCCAAGAATGACAGCTGCCTACATCTGAAACATGGTGGA
AAACGAAGCTCATTCCCAACGTGCAAAGCCAAGGCAGCGACCCCAGGACCTCTTCTGGAG
ATGGAAGCTTGTTGAAAACCCAGACTGTCTCCACGGCCTGCCCAGTCGACCCCAAAGGAA
CACTGACATCAATTTTACCCTGAGGTCACTGCTAGAGACGCTGATCCATAAAGACAATCA
CTGCCAACCCCTCTTTCGTCTACTGCAAGAGCCAAGTTCCAAAATAAAGCATAAAAAGGT
TTTTTAAAAGGAAATGTAAAAGCACATGAGAATGCTAGCAGGCTGTGGGGCAGCTGAGCA
GCTTTTCTCCCCTCATATCTGCGTGCACTTCCCAGAGCATCTTGCATCCAAACCTGTAAC
CTTTCGGCAAGGACGGTAACTTGGCTGCATTTGCCTGTCATGCGCAACTGGAGCCAGCAA
CCAGCACATCCATCAGCACCCCAGTGGAGGAGTTCATGGAAGAGTTCCCTCTTTGTTTCT
GCTTCATTTTTCTTTCTTTTCTTTTCTCCTAAAGCTTTTATTTAACAGTGCAAAAGGATC
GTTTTTTTTTGCTTTTTTAAACTTGAATTTTTTTAATTTACACTTTTTAGTTTTAATTTT
CTTGTATATTTTGCTAGCTATGAGCTTTTAAATAAAATTGAAAGTTCTGGAAAAGTTTGA
AATAATGACATAAAAAGAAGCCTTCTTTTTCTGAGACAGCTTGTCTGGTAAGTGGCTTCT
CTGTGAATTGCCTGTAACACATAGTGGCTTCTCCGCCCTTGTAAGGTGTTCAGTAGAGCT
AAATAAATGTAATAGCCAAACCCACTCTGTTGGTAGCAATTGGCAGCCCTATTTCAGTTT
ATTTTTTCTTCTGTTTTCTTCTTTTCTTTTTTTAAACAGTAAACCTTAACAGATGCGTTC
AGCAGACTGGTTTGCAGTGAATTTTCATTTCTTTCCTTATCACCCCCTTGTTGTAAAAAG
CCCAGCACTTGAATTGTTATTACTTTAAATGTTCTGTATTTGTATCTGTTTTTATTAGCC
AATTAGTGGGATTTTATGCCAGTTGTTAAAATGAGCATTGATGTACCCATTTTTTAAAAA
AGCAAGGCACAGCCTTTGCCCAAAACTGTCATCCTAACGTTTGTCATTCCAGTTTGAGTT
AATGTGCTGAGCATTTTTTTAAAAGAAGCTTTGTAATAAAACATTTTTAAAAATTGTCAT
TTAAAAAAAAAAAAAAAAAA

Protein Sequence

>51176 : length: 414
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPITGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESASGGKRSSFPTCKAKAATPGPLLEMEAC