ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

51053

Name

GMNN

Synonym

Gem;geminin, DNA replication inhibitor;GMNN;geminin, DNA replication inhibitor

Definition

geminin

Position

6p22.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Removal of licensing factors from origins;PID Reactome;500964

Pathway

DNA Replication;Reactome;REACT:383

Pathway

Association of licensing factors with the pre-replicative complex;PID Reactome;500987

Pathway

CDT1 association with the CDC6:ORC:origin complex;PID Reactome;500869

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

External Links

Links to cell senescence gene database

51053

Links to epithelial mesenchymal transition gene database

51053

Links to ovarian cancer gene database

51053

Links to endometrial cancer gene database

51053

Links to iHOP

51053

Sequence Information

Nucleotide Sequence

>51053 : length: 1680
TTCTGTGTGAATGTGCTTTTATGTGAATTTTTTTGGGGAGAGGATTCACAGAGTATTAAA
TAGTTTTCCAAAAAGGTTAAGACCCATTAATATACAAGAAACTTTCTGGCTTTAAGAGTC
TATTATTCCAATGCATACTCTATATACAGAAAATAATAATAGTAATGTTACATTGTTTTA
GGCAAAAGTCTATATAGCTTATATAAATAAAAGTTAAATCTTGGAAATGGTCTTTTTTTT
TGGTGACAGTTACTTAGCTGGCTTCTTTGACCATTATTAACAGAAAGCATTTAAATAACA
CCTCTTGTTAGTAAGGTTCCAACGTTACATTTTCTTTTATTTGTCTGGAGACTGTTGACT
AATCTATAATCTAAATTATATCTGAAATGTTGATGTAATATTTGTCCTCACAGTAGCTGG
CATTTGTCCTTCAGTTAAATGGTGAGATAATAATCAGCAGTAGAAACTTTACCGTGGGAA
AGGTGAACTCTTATCATGTGAAGTACAGTGTGGAATCAGTAACTTTCTCACGCTGGTATG
GTATCATGTTCTTGCTAACCTTGTTTGAGTATTCACCATTGTTTGCTATCCCATGGTGGC
AGTATAACTAATGATATTTTGCAAAAATAGGAGAGAACTTTCAGATCATGAAATATACAG
GAAGTTGTTTACATATTACAAGGAAGGCAATATTTTCACCAAAACAATAGCTTGGGCATT
TTAGAGTATTTTAGTATGCCTCAGGCACTGACATTTTAGCCACCTTCTAATGAATGGGCT
TGAAGCAGAACTGCTTCTACTATCAGAATAGTTCTGTCCCAAGAAGAACTCTGAAGATGA
TTCAGCCTTCTGCATCTGGATCTCTTGTTGGAAGAGAAAATGAGCTGTCCGCAGGCTTGT
CCAAAAGGAAACATCGGAATGACCACTTAACATCTACAACTTCCAGCCCTGGGGTTATTG
TCCCAGAATCTAGTGAAAATAAAAATCTTGGAGGAGTCACCCAGGAGTCATTTGATCTTA
TGATTAAAGAAAATCCATCCTCTCAGTATTGGAAGGAAGTGGCAGAAAAACGGAGAAAGG
CGCTGTATGAAGCACTTAAGGAAAATGAGAAACTTCATAAAGAAATTGAACAAAAGGACA
ATGAAATTGCCCGCCTGAAAAAGGAGAATAAAGAACTGGCAGAAGTAGCAGAACATGTAC
AGTATATGGCAGAGCTAATAGAGAGACTGAATGGTGAACCTCTGGATAATTTTGAATCAC
TGGATAATCAGGAATTTGATTCTGAAGAAGAAACTGTTGAGGATTCTCTAGTGGAAGACT
CAGAAATTGGCACGTGTGCTGAAGGAACTGTATCTTCCTCTACGGATGCAAAGCCATGTA
TATGAAATGCATTAATATTTGACTGTTGAGAATTTTACTGCCGAAGTTTACCTCCACTAG
TTCTTTGTAGCAGAGTACATAACTACATAATGCCAACTCTGGAATCAAATTTCCTTGTTT
GAATCCTGGGACCCTATTGCATTAAAGTACAAATACTATGTATTTTTAATCTATGATGGT
TTATGTGAATAGGATTTTCTCAGTTGTCAGCCATGACTTATGTTTATTACTAAATAAACT
TCAAACTCCTGTTGAACATTGTGTATAACTTAGAATAATGAAATATAAGGAGTATGTGTA

Protein Sequence

>51053 : length: 209
MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTS
TTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKL
HKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEET
VEDSLVEDSEIGTCAEGTVSSSTDAKPCI