ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5089

Name

PBX2

Synonym

G17|HOX12|PBX2MHC;pre-B-cell leukemia homeobox 2;PBX2;pre-B-cell leukemia homeobox 2

Definition

homeobox 12|homeobox protein PBX2|pre-B-cell leukemia transcription factor 2

Position

6p21.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

5089

Links to epithelial mesenchymal transition gene database

5089

Links to ovarian cancer gene database

5089

Links to endometrial cancer gene database

5089

Links to iHOP

5089

Sequence Information

Nucleotide Sequence

>5089 : length: 3231
CTCTCTCACACACACCCCCGCTTGGGCCTCCTCTCTCTCTCCGGCTCCATTTTCTCCGCC
GCCGGGGGCCGGGGTCTCCTGTGGGGGGCCCAGCCGGTATCCCAGGTCTCCCTTCAGTGC
CGGGGTGAACCCCCGGGGGAGCCGGGAGCCGGGGGCAGACGGGCGGGGGTTGGGGCGGAG
GGAGCAGCGGCCCCAGCGAGTTTGGGGGGAGAAGTAACCAGGCGGGGGGAGGGGCGGAGC
AGGGAGGGGGCCTCAGGGCCCCCCCCCAGCTATGGACGAACGGCTACTGGGGCCGCCCCC
TCCAGGCGGGGGCCGGGGGGGCCTGGGATTGGTGAGTGGGGAGCCTGGGGGCCCTGGCGA
GCCTCCCGGTGGCGGAGACCCCGGTGGGGGTAGCGGGGGGGTCCCGGGAGGCCGAGGGAA
GCAAGACATCGGGGACATTCTGCAGCAGATAATGACCATCACCGACCAGAGCCTGGACGA
GGCCCAGGCCAAGAAACACGCCCTAAACTGCCACCGAATGAAGCCTGCTCTCTTTAGCGT
CCTGTGTGAAATCAAGGAGAAAACTGGCCTCAGCATTCGGAGCTCCCAGGAGGAGGAGCC
GGTGGACCCACAGCTGATGCGCTTGGACAACATGCTTCTGGCAGAGGGTGTGGCTGGGCC
CGAGAAAGGGGGCGGCTCAGCAGCAGCAGCTGCAGCCGCTGCAGCCTCTGGTGGTGGTGT
GTCCCCTGACAACTCCATCGAACACTCGGACTATCGCAGCAAACTTGCCCAGATCCGTCA
CATATACCACTCGGAGCTGGAGAAGTATGAGCAGGCATGTAATGAGTTCACGACCCATGT
CATGAACCTGCTGAGGGAGCAGAGCCGCACCAGGCCCGTGGCCCCCAAAGAGATGGAACG
CATGGTGAGCATCATCCATCGAAAGTTCAGCGCCATCCAGATGCAGCTGAAGCAGAGCAC
CTGCGAGGCTGTGATGATCCTGCGCTCCCGTTTCCTGGATGCCAGACGAAAGCGCCGTAA
CTTCAGCAAACAGGCCACTGAGGTCCTAAATGAGTATTTCTACTCCCACCTGAGTAACCC
ATATCCTAGTGAGGAGGCCAAGGAGGAGCTTGCCAAGAAGTGTGGCATCACCGTGTCTCA
GGTCTCCAACTGGTTTGGCAACAAGAGGATTCGCTATAAGAAAAACATCGGAAAGTTCCA
AGAGGAGGCAAACATCTATGCTGTCAAGACCGCCGTGTCAGTCACCCAGGGGGGCCACAG
CCGCACCAGCTCCCCGACACCCCCTTCCTCTGCAGGCTCTGGCGGCTCTTTCAATCTCTC
AGGATCTGGAGACATGTTTCTGGGGATGCCTGGGCTCAACGGAGATTCCTATTCTGCTTC
CCAGGTGGAATCACTCCGACACTCGATGGGGCCAGGGGGCTATGGGGATAACCTCGGGGG
AGGCCAGATGTACAGCCCACGGGAAATGAGGGCAAATGGCAGCTGGCAAGAGGCTGTGAC
CCCCTCTTCAGTGACATCCCCAACGGAGGGACCAGGGAGTGTTCACTCTGATACCTCCAA
CTGATCTTGCCCCTCAGGGTCACAGGGGTGGGGGCTCTCACAAGGCGACTTGAAGAGGAC
GCAGGCTTCCAGAGGACAAACCCCAATACAGGAGAAGCACAAGACAGAGAAGGGCCAATG
GGGTCATCCCCTCCCTAACGAGACTCTCTGTGCTGGGGGTGCTAATTACATGGCAGGAAG
AATGGGGCCTCTAAGGGGAGTGTGGGGTCTGTCTCTCCCTTTTTTCCATCTTTTTCCTCT
CTCGCTTTCTTTCTTACACAGAAACATACACATACCGAGAAACCTATTTCTCAGACCCCT
TTTTCTCCTCTGTCTTTCTCTCTCCCTCTCCCACACCTCACACACACATACTCCCACTTG
CAACTATTCTGTTTCTCTCCTGGGCTCCCCCACTTTCCCTTCCCCACCCCACTTGTATGC
TCTGGAATCTGTGGAGACGCCAGCCCTGCCCAATCAGAGATGCCAAAAATGGGGACATGA
CTTCTGGACAGAGGACATGGGCCACGCCCCCATGCATCCCCACCCCCGCCCCTCCGGACG
GCTTACTTACCTCATACGCAGCTCATCTTAAACCAATAGAATCGCTCGGTGGACGAGAGT
GTCTGACTCAGATATCTACCTCGGAGGGAGTTTCTGCTACTTTAGGGAATTATTGACTGG
GCTTTGGGGTTGAACTTTTTTTTTTTTAAAGAAAGAAAAAGAAACCCTGGGATCCATCTG
TTTTTTTTGTTGTTGTTGTTGTTTTTGTTGTTGTTGGTGGTGGTGGTGGTGGTGGTTCTT
AATTTTTAATTTAGTTTGGGGAAGTAGCTTGTTTTTTTTTTTATAAATATGTTGATTTCT
TGTCTTTTTTTTTTTTTATTTCTTACTTTCCCATATTAGGGGTGATAGCCAAAGGGGTTC
TGGTAAGAGAAAGGGGGACAAACAGAACTGGTAAAGAGGCCCCCCTGGCTCCAGGCCTGT
CCATCAGGAAGTAAATTTTACAGGGCACCAAGCTTTGCCCCCTAAAATCCCTTAGGTGTT
CTTTGTTCATGCAGGCAGGTTTCTGCCGCATTTGATGTGGAGGCAGTGAAGGGCTTGCCC
TGCTGGCCTCTCATCCCCCTTCTTCCCACAACCCTTGGGCAGGGCTGGACTCAGTAATTT
TGAGGAAATTGAAGATGCCATCTTCCCCTGTGAGTGACATGTCTTTAATTTTTTAAAAAA
CTACTATTTGAAAATTGGAGGGGGAAGAATGGGAAGGGAGTTATTGCCAAATATGTTAAA
TATGGGTTGGGGTGCTTGTATATGTATCTTCCTCAATTTCCCCATAAATGAGGTATCTTT
TTGTCACACCAAAATCAAGGGGTAGGGAGAGGGAGGAGGTTGCAAAAAGCCAGATGTGGG
GGAAAAGTAACATCAACACTGTCCCATCCTCAGCCCTGAACTAGCTACCATCTGATCCCC
TCAGACATTCTCAGGATTTTACAAGACTGTCAGAGTGGGGAACCCCTCCCATTAAAGATC
CGGGCAGGACTGGGGACAGGTTGGAAGTGTGATGGGTGGGGGGGTGGGAGGCATGGGCCG
GGGGCAGTTCTCTCCTCACTTGTAAACTTGTGTAGTTTCACAGAAAAAAAACAAAATGCA
GTTTTAAATAAAGAAATTTCTTTTTTCCCTGGGAAAAAAAAAAAAAAAAAA

Protein Sequence

>5089 : length: 430
MDERLLGPPPPGGGRGGLGLVSGEPGGPGEPPGGGDPGGGSGGVPGGRGKQDIGDILQQI
MTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRSSQEEEPVDPQLMRLDN
MLLAEGVAGPEKGGGSAAAAAAAAASGGGVSPDNSIEHSDYRSKLAQIRHIYHSELEKYE
QACNEFTTHVMNLLREQSRTRPVAPKEMERMVSIIHRKFSAIQMQLKQSTCEAVMILRSR
FLDARRKRRNFSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRI
RYKKNIGKFQEEANIYAVKTAVSVTQGGHSRTSSPTPPSSAGSGGSFNLSGSGDMFLGMP
GLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSWQEAVTPSSVTSPTEG
PGSVHSDTSN