ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5087

Name

PBX1

Synonym

pre-B-cell leukemia homeobox 1;PBX1;pre-B-cell leukemia homeobox 1

Definition

homeobox protein PBX1|homeobox protein PRL|pre-B-cell leukemia transcription factor 1

Position

1q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Disease

Cancers;KEGG DISEASE

Disease

Diabetes mellitus;FunDO

Disease

Prostate cancer;FunDO

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Leukemia, acute pre-B-cell;OMIM

Disease

Obesity;FunDO

Disease

Leukemia;FunDO

Disease

Acute lymphoblastic leukemia (ALL) (Precursor B lymphoblastic leukemia);KEGG DISEASE;H00001

Disease

Esophagus cancer;FunDO

External Links

Links to cell senescence gene database

5087

Links to epithelial mesenchymal transition gene database

5087

Links to ovarian cancer gene database

5087

Links to endometrial cancer gene database

5087

Links to iHOP

5087

Sequence Information

Nucleotide Sequence

>5087 : length: 7679
AAAGTTTGCATTGCAATCCCCCTGCCTTCCTCTCCTTTCTCCCGATCAATGCATATTTGC
AAAAGGATTAAGCCACAGATTTAAGCGCCGGGAGCCCATTTCTGCCTTGCAAAGGAGACC
GGACTGAAAAACCTAAAGCCAGCTCTGATTTCTTTTCGCCAAGTGGGAAGGTGGTTTATT
TTTCTTGCTTTTTGGAGTCAACACCCTTCCCCACCAGCCCTTATCCCCACCCTCACCCCG
CAACCCCTTCACGCCCCCTCCCCCTCCCCCTCCTCATCCTCCCACCATCCTCTAAAGAGG
CAAAGGGATTTTTTTTTTCTTTTGGTCTTCTTTTTTCCCCCTTCCCTGTTTATCCTGAAA
AGGATTTGAAGACAAGCTTGAAGGATAAAAAGCCTTGGTGCTTCCCAGGAGCCGAGCCGA
GGAGCAGAAGAGGAAGAGCCGGGGGCTGCCGTAGCCTTTGGAGATGGACGAGCAGCCCAG
GCTGATGCATTCCCATGCTGGGGTCGGGATGGCCGGACACCCCGGCCTGTCCCAGCACTT
GCAGGATGGGGCCGGAGGGACCGAGGGGGAGGGCGGGAGGAAGCAGGACATTGGAGACAT
TTTACAGCAAATTATGACCATCACAGACCAGAGTTTGGATGAGGCGCAGGCCAGAAAACA
TGCTTTAAACTGCCACAGAATGAAGCCTGCCTTGTTTAATGTGTTGTGTGAAATCAAAGA
AAAAACAGAATTGAAGGAGGCCAGGAGTCGGAACTGCCCCTCATTGTTCTTTTTGGTGAC
TAGGATACAAAGTTCTGTTCGGCACAGAGTACTCTCCTCTGCTTCTACCTCCGGGAACCC
CGTTACCCCCCAGCCCACACACCACCACCCCAGTTTTGGGTGGGGAGAAGGCAAAGGGAG
AGATCATCTCTCAAAAAGCTCCCATCAGAGCAACCATTCTGGGACTTTGAGCAGAATGCT
TAAGGCAGTGGTTCTAAAATTCCACACCACCTGTTCTTCCAGTTGTGTCCTCTCTGAGCT
GCCTCTGACGGTCACATTCCATGGCCATGTGCCACAGCAGACTTGTGATACTGATTTTAG
TGTTGTCCTTGGCCATTGGGGGAAGGGAGGAAGGAGAGAGAAGAGAAGGGGAGAGAAGAA
GAGAAATGGGAGTGGGGTCCATTCATCCATCTCTCTTGTCATTAGGGGCCCAGCAGTTCC
CACTATGGTACCTAGGAAACTAGCTTGGACCTGGAGGCCATCCAGTGACCTAGTCTGGGC
CAGTAAAGCCACCAGGCCATTTTCCTGCTTCGGACATGCTTTCTCAGCTGCCCTCCCCCT
TAGCTAAGGCTGAAATGACTCATCTTCCCGTGCCCTAGTTCCACGGGGTTTCATCTCTGT
GACTCGGGACAGAGGCCTTGGTTGCCACCAAAGGCAGCTTATGGTGTAGCTTCAGGTCTG
GCCTGACTCAGTGGCCTTCCCTCAGCTATTCACTACAGAGGCAGTTAATGAAGAAGACAC
AAGGGTAGCAGGCCTGAGGGATAACTTCAAGGCTAACGTGTCTTTTTTCCAGTACTTACT
CTTCTTTTGAATTTTAAGAATTCCAGATTTTATTCTAAGTCAGAGAATACTGTGAGAAAG
GATTTTATTGTATCCACTCTCTCCAAATGGTGTGAACATCTGGATTTGCATCCTTCCCAT
GACAGATATCACAAATTGGGTTGGGTTTTGCATGCTGAGGATGATTTTTGGTATTCAGCT
AACACCCTTCCTTTAAGGAAGTTAGAACACTTGATAAATTTTAAGCTTTTGATCCTCAGT
AGTACCCCTGGAAAATTAAGGTCCAGTGAGGTAAATTGTCTTGATTAATTATATGACATG
CACTGCTTTTTGGTGGCTCTTTTGTTGTGTTTTGTTTTTTCTTTCTCCTTCATTTTGTTA
AAATGAATTATGTGAATGTCCAGGTTAGCAGTGTTCTATTTTCATAGGATAAGCCCCATC
TCTAGTACTGTTTATTTCCATTGTGCCTATTTTTCAGGGAACTCTGTGCATTTCCACATT
TCCATCACCAGCTCTAAGAAGGTACACCTGCAGTTTGTTGTGACCCCGTTTCAGAACGGA
CAGAACCAAGTGCAGGCTTACTCTATTTGGTAGAGACTGAGTCCCAGCAAGTAGAAGTGT
CTTGCCAAGGGGATGCAATTATGAATAGGAAATGGAACTAAAAATAGAACCTAGGTATGA
CCCCAGATATTTGACCACTCTCACCAACATGATTTCTCCTTTTGGTCTCAGACCAGGACA
TTCAAGGCATCTCTCCATTTTCATATGGAGAAGCATCCAACTATGTCTCAATGGTTGATT
AGGAGACCATATCCTTCAGGAGTCATGTTGAAACTTGTCAGGGTAGTTCCTAAGGTCCTG
AGGCCTAGGATAGTACTGTATCCTGGCCCCATGAAATCTGTGGTAGATGGTAAGTGTTCA
GTATGAATTTATTTATTTGGTTAGGTGTTTTTTATCATGGTGAATACAGTTCCTTTAATA
TCAGCAAGGACTTAGTGAACATGTGCTCTTTGCCTCACAGAAAATAGAAAATGAGATATT
AGAAGGAAATAGAACAAAAACTATTTGCCTTCAAGGAGCTCACAGTCTAGTTCTGGAGAC
TGGACATAAGCAGTCTCTGCTCTCTGCTTGGACTGGTGTCACTGTGATCATTCTAAGGTA
ACGAGCCACCTTTTATTCTTTTACCCAGCCCAGTTGTTTCAGATGAAAGGATAGAGAAGC
TGGCGTCTGCTGTGATGGAGTTGATGTTTTATTTTAAGATAAAGTATAGAAGCAACTGAT
TGATGGATTATAAACTGGGAGGTCCAGGATAAAGCTTCATTCTGAGGGCATCAGTATATT
TCACTGGGAGCCTCCTGGGCATTAATTCTGCCGTTAATTTTGTTATTAGAAACCTAGCCA
AACAAAGGGAGGTGGCGAAGCTTGAGGCTGGTTTAACCTTGATGAAACAGTGATTTCACC
AAGGATGATGTTGCCCCATCCATCTTCATCCATCAAGGCACTGCTGAAATATGCTAATGA
AGCCCAAAGATAGGAGCACAGAGCAGTTAAATGGGGCGTTGCAGACGCTCTCCCTACCCC
CGTGACAGGGTGATGCCATTTACTCTCCAGATTTAGTATAGGAAAGAGAGCAATGCTGAC
GTGGTGTCGTGGTGGAAGATAGAATGGAGGCTCCACCTAATAAAAAGAAAGGGCAAAGTT
CAGGGTATATATTCTAGAAGAAGATGGGAAAACTTGGTTTTTGGTGAAGGGGTTGGTTTT
CTTAATTCTCTTTGGCTCACTTTCTAGCCAGTCCACACAAGAACCAGATATGTGGCATAC
TGCAGATAGGGCAACATTTTTAAGTTCCAGAATGTGACCTCCCACCATGTGCCAAAGCAA
GTTATTTGTTACCATGTCAGTCTGCAGCACTGTTTGTTTCCAATGGTACATGAGCTAATA
CCTTGGCTTTATTTATTTATTTATTTAAGTTACAACCTTTTGGATACTTATGACATGCTG
GGCATACTACTGAATTATTTTATATGAATTAATCTAATCAGATTCTTACAAATAGCCAAC
GAAGAAGCAAAGTTATCACATATATTTTATAGATGAAGTTTGAGAGGCTAAATTCATGTC
CAAAATTATGTAACCAGTAAGTGGCATGGTTGGGGTTTAAACTCATGTCTACCTGACTCC
AAAGCCCTTGTACAAAATCACTGTGGTCTGAAGACTCTTATGTAGGTTATAGCTGAGAAT
CCCTGATAACCATTGGGAGCAGCTTGACTCACATATTTATTGCTTGTATATTCTTTGGGT
TCAGTTTAACTTTAACTTTGGCATTCCCTTCACAATTCTTTCTTTTGTAAATAGACTATA
AGCTCTCTGAGGTCAGCAGCCAAGCCCTTTCTCTAATCTCCTAAATGTCGATGATGTCCC
TAGTTTCTATGTGGAGTGTTTACTTTTGGCATCATGCTTCTAATATAGGGTTAAAAAAGG
CTGGCCAGCTGCTTTCTGGTTTTCATTTCATACATTAGATGAAAGCCGTGGGGGATTTTA
CTTGTCTTTACAAGTTAATTCTACAGGATTCACAGTTAAATTTCTGTTTCTTTGAATTTA
TTGGTGGATCCACTTTTGTTTCCTACTAGTACATTACCTATCTAGTCTATATCCAACTGT
ACAGAAAAAAGTAAACCGCAAATGAAATTTTATTATTATGTATTAAACAGCATCTTTGGA
GCAGTCTATATTAGGAGGTGTGTGTCAAATTCTGCTCATCTTAGGACCCTAGACAGTTCC
TCTAAGAGAGCCTGCCACCCTTCGCTTACAAAATGCAGACCCTGAGCTAAGAGGTGGTCT
TGGGCAAATCAGGCAAAACAATTCCTAAATCTAAAACGTTTATCAGCTTTTGTTTTTTTT
TTTCCTAAATGGAGATAAAGTTGGAAGTTAAAAGCAAAAAAGAAGGATGGATTAAAAAAT
ATTTAAATAAGATGCCAAGTAACATGAATTGCCTGAAATAGACTGTTTCAGGATAAAAAC
TGTATCTTGGCCTTAATGTGTCTTGTGCCATTTATTAAATCAGTTCTGAACTTTGGGGAC
TCCAGACTGTTATTAAAGAGTTAATAACCAAAGGCTTCAACGTCCAGGATGTTGTGTGGG
TCAGTGTATCTTGCCAAGAGGTAACATCAGCCAGTGGAATCAGTTGGGCTCTCCGTCTGG
CAGATCTGTCTCTTTCAGCTGCTCCTCCTCCAGTTTCTAGTCTTGGAGTTCATATACAGT
AAATCTTTCTCTTAATAAAGCCGTTTTTCAAATCTGACTTTGGACTAGGGACTGCTTTTT
CTCCAAATGCAACAGCTGTTAAACATGGTGCATTGGGCACGGTGTATATCTCTTTGTTTA
GTTTTGGGTTTTTAATATGAGCAGAGACATAAAGGAGTGGGAGGACTCTATCGATTTCTT
TCTACCCATGAGTCATCCACTGGGTTTGGAAATAAGGCCTCCAGCCTCAAAAGGCTTCTG
GGCTCCCTGGGCTTCTCACCCTTAAGGATGAAGCCTATTGTGCCCTAATAACCAGTACAG
GATTCCCCCCCTTCTTTTGGTGAGATAGAATTGTAGAGCTCAAGGTGTCCGCCAGCAGAG
GCCAGACCTTTTGGCCCCTATCTGTCCCATTTACATGGGGAAAAGCATTTTTGCCCCCTT
GCTCTCTGGTCCTTCTGTCACTGTCTCTGTTCCCAATGCACTAGGGAGCATTAACTCCCT
GAAGGGGAAAAAAGTTCACAAAAGAAATGAATTATGCATATGGAATTCATTTCCTTGATG
AATAGGGAATCTGAACAAACTCCATGGCTGTTTGATTTTAAGGCAGAGGAGAAGGGGGGC
TTAGGGCTAAAGAGTATAGTGGGGGGTGATCAAAAAGAACTTGGAACAAGAGAGGTGGGA
GAAAAACCATGGCAGGAGGACTTGGGATGGAAATATTGAGGACAAAGTAAGGGGACCTTT
GAAAATAGTTGAGGGCCCATTATTCTTGCCAACACGTACACACAGATATATACCTCACTC
CCGATTAATGTGCAAATTTGTCCCCAGGGAAATTGGAAATGGTAATGAGATTATACTGGG
CAGAAATGACAACACTAAGGTGATGTGACCGTCCTGAATTAAAGTTTTTCAGTGATTTTT
TAACTTTCTTCAGTCCAGGTTAACAATGGGCGCTTTGAATTTTGAGGCAGGAGTTGTGTG
ATAGGTAAAGAACTGCATTGAGAAGTGGAAGACTTGGATCCAAGCCTCAGAAGACACAGA
CTGTGTGACTGTGGGCAAGTCACCTCATCTTTCTGTCTCAGTTATCTCATCTATAAGTGG
GGATTATGGCAACTGCCCTGGGGAAAAAATTATAAGGGCCAAACAAAAGTGCTTTTATGC
ATAACACAAGATGCGAATCTGAAGGGATTTTATTTTTCTCTCTGTGCCTCCTTTTCTTGA
TGGCATTTTGGTTATTCAGACCTAGTCTTTTCAGCAAGTCAGAATTTCTTTGGAGCAGAA
GAATGAAGGGGAAATTGATTCAGGAGCAGCATGCTGGTTAAAGGAACAAAGAAACAAGTG
AAAAATCCCATTTTAATCCTCACCGCATCTATGTTATGAAAACCATTTAAAATAATCAAT
CTGATGTTTTTGGCAAATTTAGGTACTGAATCAGTAGTGGTTACTGCATAACTAGTTTGA
TCAACAGTAGGAAAGCTTGTCATTGACAGCCACATACATTATGGAATCAACTAGAGGGTG
GTTTTTAGAGCTTCCCTTGTAGGCTGACTACCTAGAAGAGGCAACCTCTGACCTGGCTGC
CAAAGACCTGTGGATGCTTCTGATGGGGAGATATGGCCAAACCGACCCCTTACTTCTAAT
TGTGCTCCATTATTCCTTGTTTCTGAATGCAAAAAAGACTTGGGGACACCAAGTCTTCAG
GAGAGATAATAGGTAGAAAGTCACACATACCTGTGTACATTTGTTAGGATATGTCCCTGC
TCGTTGAGAGGAGAGAGTTTTTTTGATAGTTATGGGGTCTTAAATCCATTTCAGGATTGA
GTAGATTGAGCAGGTCCAACTACCGCCATGTCTCTTTATTTTTCTCACCACCCAATTTCA
GTACATGCAGTTTTTCACAGAGGTGTGTTTGCTTTACAGCAAATCCTTTTTAGGGGTCAG
GATGTGTAGTGGAATGCCATTGTATCCTTTAGGACTGCCCACCGCAAACACATGCTGTGC
ACTCATACCTTTAGTGTGGTGGCATTCAGTCTGGTCTGCAGGGCATGGCCCTCGGAAGAG
TGTGGAGATGTCCCAGGACAGCCTTCCTGGTAGTAAGGGGGGCAGCCCTACAGGCTCGGG
GGTCCCACCCCAACTTCAACCCCTGCACCTTTGTTTCATGGATTTTATTTGCTTGGGTTT
GTGGGAAAGAGTCTGCTTTTAAGTAACCTTTGAAACCCAGTGGTGCAGAGAATAGACCAA
TGCCTAGTATGAATTATTTATTTGTTTATTAAGATTTTCATGGCACCTTCCCTTTCAAAG
CTCAAGGCACTGAATGAACTCTTCAAACTGATAGCAGTTAGCACTAAAGGTTGAACAGGG
GCCGTTGGAGGAGGAACCACTAGGGAGGATGAGAAAAGAGGGAGGAAGAGCAGAGAGAAG
AGCACGGCAGTCCGGACCCCAGAGCCACCACTACAGCCAAAGGAGGAAAATCGTAAAGAC
TGCAGGCTTCCCAGGAAGGAATCCAGCCCTGCTGGGAAGTTGTTTTGTTATCAGGGAAAG
TCACTTCCTTCTGTCAGCCTCCTCCATGAAATCGAGGTGACCTAGTTGACCCCCTGGGCC
CCTCCCAGGTATGATCTTTTAAGAAGCCTGAGGAGCTTTCCTTTTTAGGTGAGCAGGCCT
AACCCTTCTGCCAAGTTGTTACGGCAATAAAAATCATCATAAAATTTTTTTTAATGTTAT
GCATAAACCTTTCAATAACAAGTATATTTGGTACAGAGTGGTTTTCAACCCTGGCTGAAC
ATTAAAATCACCTGGGGAACTTTTAAAAAATATTACTGGTGCCTGGGATCTACCCTGGAA
TGATGAAATCAGAACATCTGGGGGCTGGTGCTGAGCATCTGTATTTTCTCAAAGCACCC

Protein Sequence

>5087 : length: 486
MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDE
AQARKHALNCHRMKPALFNVLCEIKEKTELKEARSRNCPSLFFLVTRIQSSVRHRVLSSA
STSGNPVTPQPTHHHPSFGWGEGKVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGG
GSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLR
EQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQA
TEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANI
YAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVG
ANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEGPGSV
HSDTSN