ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5078

Name

PAX4

Synonym

KPD|MODY9;paired box 4;PAX4;paired box 4

Definition

paired box gene 4|paired box protein Pax-4|paired domain gene 4

Position

7q32

Gene Type

protein-coding

Pathways and Diseases

Pathway

Maturity onset diabetes of the young;KEGG PATHWAY;hsa04950

Pathway

Regulation of beta-cell development;Reactome;REACT:13698

Pathway

Regulation of gene expression in endocrine-committed (NEUROG3+) progenitor cells;PID Reactome;500521

Disease

diabetes, type 2;GAD

Disease

Diabetes mellitus;FunDO

Disease

diabetes, type 1;GAD

Disease

IMMUNE;GAD

Disease

Leukemia;FunDO

Disease

Diabetes mellitus, ketosis-prone;OMIM

Disease

METABOLIC;GAD

Disease

Maturity-onset diabetes of the young, type IX;OMIM

Disease

Diabetes mellitus, type 2;OMIM

External Links

Links to cell senescence gene database

5078

Links to epithelial mesenchymal transition gene database

5078

Links to ovarian cancer gene database

5078

Links to endometrial cancer gene database

5078

Links to iHOP

5078

Sequence Information

Nucleotide Sequence

>5078 : length: 2010
CAAAGACTCACCCGTGAGCCAGCTCTCAAAGAAAGCAGCTTGCGTTGACAGCCTGGGGGC
AGCAAGGATGCAGTCTCCCAGGAGAGGATGCACTCGGTGGTGGGAAGCCAGGCTGGAGGG
GCCTGAGTGACCCTCTCCACAGGCGGGCAGGGCAGTGGGAGAGGTGGTGTGTGGATACCT
CTGTCTCACGCCCAGGGATCAGCAGCATGAACCAGCTTGGGGGGCTCTTTGTGAATGGCC
GGCCCCTGCCTCTGGATACCCGGCAGCAGATTGTGCGGCTAGCAGTCAGTGGAATGCGGC
CCTGTGACATCTCACGGATCCTTAAGGTATCTAATGGCTGTGTGAGCAAGATCCTAGGGC
GTTACTACCGCACAGGTGTCTTGGAGCCAAAGGGCATTGGGGGAAGCAAGCCACGGCTGG
CTACACCCCCTGTGGTGGCTCGAATTGCCCAGCTGAAGGGTGAGTGTCCAGCCCTCTTTG
CCTGGGAAATCCAACGCCAGCTTTGTGCTGAAGGGCTTTGCACCCAGGACAAGACTCCCA
GTGTCTCCTCCATCAACCGAGTCCTGCGGGCATTACAGGAGGACCAGGGACTACCGTGCA
CACGGCTCAGGTCACCAGCTGTTTTGGCTCCAGCTGTCCTCACTCCCCATAGTGGCTCTG
AGACTCCCCGGGGTACCCACCCAGGGACCGGCCACCGGAATCGGACTATCTTCTCCCCAA
GCCAAGCAGAGGCACTGGAGAAAGAGTTCCAGCGTGGGCAGTATCCTGATTCAGTGGCCC
GTGGAAAGCTGGCTACTGCCACCTCTCTGCCTGAGGACACGGTGAGGGTCTGGTTTTCCA
ACAGAAGAGCCAAATGGCGTCGGCAAGAGAAGCTCAAGTGGGAAATGCAGCTGCCAGGTG
CTTCCCAGGGGCTGACTGTACCAAGGGTTGCCCCAGGAATCATCTCTGCACAGCAGTCCC
CTGGCAGTGTGCCCACAGCAGCCCTGCCTGCCCTGGAACCACTGGGTCCCTCCTGCTATC
AGCTGTGCTGGGCAACAGCACCAGAAAGGTGTCTGAGTGACACCCCACCTAAAGCCTGTC
TCAAGCCCTGCTGGGGCCACTTGCCCCCACAGCCGAATTCCCTGGACTCAGGACTGCTTT
GCCTTCCTTGCCCTTCCTCCCACTGTCACCTGGCCAGTCTTAGTGGCTCTCAGGCCCTGC
TCTGGCCTGGCTGCCCACTACTGTATGGCTTGGAATGAGGCAGGAGTGGGAAGGAGATGG
CATAGAGAAGATCTAATACCATCCTGCCCATTGTCCTTACCGTCCTGCCCATACAGACTG
TGGCTCCTTCCTCCTTCCTGTGATTGCTCCCTCCTGTGTGGACGTTGCCTGGCCCTGCCT
CGATGCCTCTCTGGCGCATCACCTGATTGGAGGGGCTGGTAAAGCAACACCCACCCACTT
CTCACACTAGCCTTAAGAGGCCTCCACTCAGCAGTAATAAAAGCTGTTTTTATTAGCAGT
AGTTCTGTTGTCCATCATGTTTTCCCTATGAGCACCCCTATGCCCACTCTAATATTCAAC
AATTATAGACAATTTGCCCTATCATTTATTTACATCTATGTATCTACCATCTAATCTATG
CATGTATGTAGGCAATACATGTATCTAAACAATGTATTTGTCAATGCATCAATTTACCTA
CTCTATGTATGCATCTATATGTGTATTATGTATGCGTGCATGCGTGCGCGCACACACACA
CACACACACACACACTGACATTATATCATGGCATTTTATTCCTAAATCTTCCAGCATGCA
TCCCCAAAAAACAAGAAACTTGTCTTACATAATCACAATAATATATCCACATCTAAGAAA
ATTTACTGTAACTTCTTAATCTAAGAAAATTATGTATTTTTGTCATATGTATTTTGTCAT
ATGTATTTTGTATTTGCATATGTATTTTGTATTTGCATATGTATTTTTGTCATAGCAGCA
AACAGAGTGAAATGCCATTTTTCATATTCT

Protein Sequence

>5078 : length: 351
MHQDGISSMNQLGGLFVNGRPLPLDTRQQIVRLAVSGMRPCDISRILKVSNGCVSKILGR
YYRTGVLEPKGIGGSKPRLATPPVVARIAQLKGECPALFAWEIQRQLCAEGLCTQDKTPS
VSSINRVLRALQEDQGLPCTRLRSPAVLAPAVLTPHSGSETPRGTHPGTGHRNRTIFSPS
QAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRAKWRRQEKLKWEMQLPGA
SQGLTVPRVAPGIISAQQSPGSVPTAALPALEPLGPSCYQLCWATAPERCLSDTPPKACL
KPCWGHLPPQPNSLDSGLLCLPCPSSHCHLASLSGSQALLWPGCPLLYGLE