ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5077

Name

PAX3

Synonym

CDHS|HUP2|WS1|WS3;paired box 3;PAX3;paired box 3

Definition

paired box homeotic gene 3|paired box protein Pax-3|paired domain gene 3|paired domain gene HuP2

Position

2q35

Gene Type

protein-coding

Pathways and Diseases

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

regulation of transcriptional activity by pml;PID BioCarta;100067

Disease

Spinal dysraphism;FunDO

Disease

Cancers;KEGG DISEASE

Disease

Rhabdomyosarcoma 2, alveolar;OMIM

Disease

Thrombophlebitis;FunDO

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Craniofacial-deafness-hand syndrome;OMIM

Disease

Gestational diabetes;FunDO

Disease

Melanoma;FunDO

Disease

Alveolar rhabdomyosarcoma;KEGG DISEASE;H00037

Disease

Waardenburg syndrome, type 3;OMIM

Disease

Rhabdomyosarcoma;FunDO

Disease

Waardenburg syndrome, type 1;OMIM

Disease

Neoplasm metastasis;FunDO

External Links

Links to cell senescence gene database

5077

Links to epithelial mesenchymal transition gene database

5077

Links to ovarian cancer gene database

5077

Links to endometrial cancer gene database

5077

Links to iHOP

5077

Sequence Information

Nucleotide Sequence

>5077 : length: 3359
ACTCGGTGTCACCACAGGAGGAGACTCAGGCAGGCCGCGCTCCAGCCTCACCAGGCTCCC
CGGCTCGCCGTGGCTCTCTGAGCCCCCTTTTCAGGGACCCCAGTCGCTGGAACATTTGCC
CAGACTCGTACCAAACTTTTCCGCCCTGGGCTCGGGATCCTGGACTCCGGGGCCTCCCCG
TCCTCCCCTTTCCCGGGTTCCAGCTCCGGCCTCTGGACTAGGAACCGACAGCCCCCCTCC
CCGCGTCCCTCCCTCTCTCTCCAGCCGTTTTGGGGAGGGGCTCTCCACGCTCCGGATAGT
TCCCGAGGGTCATCCGCGCCGCACTCGCCTTTCCGTTTCGCCTTCACCTGGATATAATTT
CCGAGCGAAGCTGCCCCCAGGATGACCACGCTGGCCGGCGCTGTGCCCAGGATGATGCGG
CCGGGCCCGGGGCAGAACTACCCGCGTAGCGGGTTCCCGCTGGAAGTGTCCACTCCCCTC
GGCCAGGGCCGCGTCAACCAGCTCGGCGGTGTTTTTATCAACGGCAGGCCGCTGCCCAAC
CACATCCGCCACAAGATCGTGGAGATGGCCCACCACGGCATCCGGCCCTGCGTCATCTCG
CGCCAGCTGCGCGTGTCCCACGGCTGCGTCTCCAAGATCCTGTGCAGGTACCAGGAGACT
GGCTCCATACGTCCTGGTGCCATCGGCGGCAGCAAGCCCAAGCAGGTGACAACGCCTGAC
GTGGAGAAGAAAATTGAGGAATACAAAAGAGAGAACCCGGGCATGTTCAGCTGGGAAATC
CGAGACAAATTACTCAAGGACGCGGTCTGTGATCGAAACACCGTGCCGTCAGTGAGTTCC
ATCAGCCGCATCCTGAGAAGTAAATTCGGGAAAGGTGAAGAGGAGGAGGCCGACTTGGAG
AGGAAGGAGGCAGAGGAAAGCGAGAAGAAGGCCAAACACAGCATCGACGGCATCCTGAGC
GAGCGAGCCTCAGCACCCCAATCAGATGAAGGCTCTGATATTGACTCTGAACCAGATTTA
CCACTAAAGAGGAAACAGCGCAGAAGCCGAACCACCTTCACAGCAGAACAGCTGGAGGAA
CTGGAGCGTGCTTTTGAGAGAACTCATTACCCTGACATTTATACTAGGGAGGAACTGGCC
CAGAGGGCGAAGCTCACCGAGGCCCGAGTACAGGTCTGGTTTAGCAACCGCCGTGCAAGA
TGGAGGAAGCAAGCTGGGGCCAATCAACTGATGGCTTTCAACCATCTCATTCCCGGGGGG
TTCCCTCCCACTGCCATGCCGACCTTGCCAACGTACCAGCTGTCGGAGACCTCTTACCAG
CCCACATCTATTCCACAAGCTGTGTCAGATCCCAGCAGCACCGTTCACAGACCTCAACCG
CTTCCTCCAAGCACTGTACACCAAAGCACGATTCCTTCCAACCCAGACAGCAGCTCTGCC
TACTGCCTCCCCAGCACCAGGCATGGATTTTCCAGCTATACAGACAGCTTTGTGCCTCCG
TCGGGGCCCTCCAACCCCATGAACCCCACCATTGGCAATGGCCTCTCACCTCAGGTAATG
GGACTCCTGACCAACCACGGTGGGGTACCTCATCAGCCCCAGACTGATTACGCGCTCTCC
CCTCTCACCGGGGGTCTGGAACCTACCACCACGGTGTCGGCCAGCTGCAGTCAGAGACTA
GACCATATGAAGAGCTTGGACAGTCTGCCAACATCTCAGTCCTACTGTCCACCCACCTAT
AGCACCACAGGCTACAGTATGGACCCTGTCACAGGCTACCAATATGGGCAGTATGGACAA
AGTGCCTTTCATTATCTCAAGCCAGATATCGCGTAAGTGAACTGTCCACTTGGAGCTAAA
ACTGGCCCTGTTTCTGGTCTTCGCAGCCTAGATATGAAGAATCTGCTCTGAAAACAAAAA
AAAATTACCCTTTTGTTGGGGGGGGTGGGGCAGTGGTCCCAATAGGAGACAAAGGAGAGT
GATTGATTTTCTTCCTCCAATAGTTGGTTTCAAATCCTTTTGAACACGTTCGACAAAAGC
AGTGGAGAAGAGGAAGACCTGGAGCAATAAAAGACAAATGCAACATTTTAAGGCAATGGT
TTCACATGGTTACATATCAAAACATCCCAATTCTTTAGTGCTGATCATCGAGGAGCTAGA
ACATTCCATTTGCTTGTGTGCGTGCGTGCGTGTGTGTGTGTGTGTGTGTATTGAGATTTA
CCCAGACTGGTTTGGGCAAGCAGACTGTTCTAAAATATAATAGAATACCCTAAAGTATAA
CATGTCGATGTTCGATGCTGATACTTCTACAACTTTAAAACTGCTCATTTCATGAAGCAA
GAATGGAGGAATCCTTGACTCTTACACACTGGAAATTGAAATAAAGATAAATGCAACCAT
TTTTAGGAAGCTAGACTAGCTGTAAAGGACCTCCTAAATAAATTATTTGTTACTGTATCC
TCATTTGTAATCTAGTTGTCAATAAATGGCCCGGACATGTCTTGCTAACAGGATATGGGC
TACCAGGAAGAAGGACTTGTTTCCCTTTCCTGTGTGGGGAGAGGTGTGTGACGTTTTTCC
AGTTCACATTTATTTGGTAGCCCACCTGGGTTGGAGGAAGGGCACGGTGGAGAGAAAGTG
ACATGCATTCACATATCTGCTTATCAGTGTGCAATACTGTGTACCTCATGGATGCTTTGG
CAATGCCCAAGGCGATATAAGCAAAATCAGAAGTATATTTTTGCAGGTGCTTTTATTTTC
ACAGCCCATAATTCATAGTGATAGAGTGCAGTGATGTTTGCCATTTGCTGGACAACCAAC
ACCCGGGTTGCTCCTTTGATTAGAGACCAGATCAGATAATTATGCTTTTAAACTGATTAC
GTTTACATTCTTCTCTTTTCTATGAAAGGCAGGGCAAGAACAGAAGTGTTCACATGGCTC
TCATGTACTTTTAAATTATACAATGATATCCAATATTAAAAGATTATAGGAACTGAGGTT
TACATACGTTTGTGTGGTGACATTTTAGAATGTCAATAAATTTGCTTTTTGAGATGTTGA
GAGGAACAAGAAGGTGGAAGGCAGTGTTATTTATTTCTTTCTATTCTTGGAACCACGAAT
GAGGTAGGCACAAATACATTCCTTTTAGAGTTAAGAACTATGACGTAGCGAGTTAGTGAG
ACTAGACATAGTACCGAATTTAGTTCATGCATTGGTCTTAGAGGGTGATGGAACAAGAGA
AGTACTATCTTTGTGTTGCAGCCTCAACCAACAACAATGTGTTGTAAAAATGTCTTTCAT
GTAAAAAGTGCAGTAAATATTTACTATTTATAATGAATAAACAGTTATGAAAACTTGAA

Protein Sequence

>5077 : length: 553
MIQGKRRRSVCTLDVGCRAAWALLTKAQSVNGLVMAVFSPMDGEMRSRFSRREETAAARR
LRLPFPLPARVPHYITVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPCVI
SRQLRVSHGCVSKILCRYQETGSIRPGAIGGSKPKQVTTPDVEKKIEEYKRENPGMFSWE
IRDKLLKDAVCDRNTVPSVSSISRILRSKFGKGEEEEADLERKEAEESEKKAKHSIDGIL
SERASAPQSDEGSDIDSEPDLPLKRKQRRSRTTFTAEQLEELERAFERTHYPDIYTREEL
AQRAKLTEARVQVWFSNRRARWRKQAGANQLMAFNHLIPGGFPPTAMPTLPTYQLSETSY
QPTSIPQAVSDPSSTVHRPQPLPPSTVHQSTIPSNPDSSSAYCLPSTRHGFSSYTDSFVP
PSGPSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLEPTTTVSASCSQR
LDHMKSLDSLPTSQSYCPPTYSTTGYSMDPVTGYQYGQYGQSAFHYLKPDIAWFQILLNT
FDKSSGEEEDLEQ