ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5076

Name

PAX2

Synonym

FSGS7|PAPRS;paired box 2;PAX2;paired box 2

Definition

paired box homeotic gene 2|paired box protein Pax-2

Position

10q24

Gene Type

protein-coding

External Links

Links to cell senescence gene database

5076

Links to epithelial mesenchymal transition gene database

5076

Links to ovarian cancer gene database

5076

Links to endometrial cancer gene database

5076

Links to iHOP

5076

Sequence Information

Nucleotide Sequence

>5076 : length: 4137
CGGGGGCCTGGCCCGCGCGCTCCCCTCCCGCAGGCGCCACCTCGGACATCCCCGGGATTG
CTACTTCTCTGCCAACTTCGCCAACTCGCCAGCACTTGGAGAGGCCCGGCTCCCCTCCCG
GCGCCCTCTGACCGCCCCCGCCCCGCGCGCTCTCCGACCACCGCCTCTCGGATGACCAGG
TTCCAGGGGAGCTGAGCGAGTCGCCTCCCCCGCCCAGCTTCAGCCCTGGCTGCAGCTGCA
GCGCGAGCCATGCGCCCCCAGTGCACCCCGGCCCGGCCCACCGCCCCGGGGCCATTCTGC
TGACCGCCCAGCCCCGAGCCCCGACAGTGGCAAGTTGCGGCTACTGCAGTTGCAAGCTCC
GGCCAACCCGGAGGAGCCCCAGCGGGGAGCGCAGTGCTGCGCCCCCCGCCCCCGCGCGCC
CCGCAGCAGCCGGGCGTTCACTCATCCTCCCTCCCCCACCGTCCCTCCCTTTTCTCCTCA
AGTCCTGAAGTTGAGTTTGAGAGGCGACACGGCGGCGGCGGCCGCGCTGCTCCCGCTCCT
CTGCCTCCCCATGGATATGCACTGCAAAGCAGACCCCTTCTCCGCGATGCACCCAGGGCA
CGGGGGTGTGAACCAGCTCGGGGGGGTGTTTGTGAACGGCCGGCCCCTACCCGACGTGGT
GAGGCAGCGCATCGTGGAGCTGGCCCACCAGGGTGTGCGGCCCTGTGACATCTCCCGGCA
GCTGCGGGTCAGCCACGGCTGTGTCAGCAAAATCCTGGGCAGGTACTACGAGACCGGCAG
CATCAAGCCGGGTGTGATCGGTGGCTCCAAGCCCAAAGTGGCGACGCCCAAAGTGGTGGA
CAAGATTGCTGAATACAAACGACAGAACCCGACTATGTTCGCCTGGGAGATTCGAGACCG
GCTCCTGGCCGAGGGCATCTGTGACAATGACACAGTGCCCAGCGTCTCTTCCATCAACAG
AATCATCCGGACCAAAGTTCAGCAGCCTTTCCACCCAACGCCGGATGGGGCTGGGACAGG
AGTGACCGCCCCTGGCCACACCATTGTTCCCAGCACGGCCTCCCCTCCTGTTTCCAGCGC
CTCCAATGACCCAGTGGGATCCTACTCCATCAATGGGATCCTGGGGATTCCTCGCTCCAA
TGGTGAGAAGAGGAAACGTGATGAAGATGTGTCTGAGGGCTCAGTCCCCAATGGAGATTC
CCAGAGTGGTGTGGACAGTTTGCGGAAGCACTTGCGAGCTGACACCTTCACCCAGCAGCA
GCTGGAAGCTTTGGATCGGGTCTTTGAGCGTCCTTCCTACCCTGACGTCTTCCAGGCATC
AGAGCACATCAAATCAGAACAGGGGAACGAGTACTCCCTCCCAGCCCTGACCCCTGGGCT
TGATGAAGTCAAGTCGAGTCTATCTGCATCCACCAACCCTGAGCTGGGCAGCAACGTGTC
AGGCACACAGACATACCCAGTTGTGACTGGTCGTGACATGGCGAGCACCACTCTGCCTGG
TTACCCCCCTCACGTGCCCCCCACTGGCCAGGGAAGCTACCCCACCTCCACCCTGGCAGG
AATGGTGCCTGAGGCTGCAGTTGGTCCCTCATCCTCCCTCATGAGCAAGCCGGGGAGGAA
GCTTGCAGAAGTGCCCCCTTGTGTGCAACCCACTGGAGCGAGTTCTCCGGCAACCCGTAC
AGCCACCCCCAGTACACGGCCTACAACGAGGCTTGGAGATTCAGCAACCCCGCCTTACTA
AGTTCCCCTTATTATTATAGTGCCGCCCCCCGGTCCGCCCCTGCCGCTGCTGCCGCTGCC
TATGACCGCCACTAGTTACCGCGGGGACCACATCAAGCTTCAGGCCGACAGCTTCGGCCT
CCACATCGTCCCCGTCTGACCCCACCCCGGAGGGAGGGAGGACCGACGCGACGCGATGCC
TCCCGGCCACCGCCCCAGCCTCACCCCATCCCACGACCCCCGCAACCCTTCACATCACCC
CCCTCGAAGGTCGGACAGGACGGGTGGAGCCGTGGGCGGGACCCTCAGGCCCGGGCCCGC
CGCCCCCAGCCCCGCCTGCCGCCCCTCCCCGCCTGCCTGGACTGCGCGGCGCCGTGAGGG
GGATTCGGCCCAGCTCGTCCCGGCCTCCACCAAGCCAGCCCCGAAGCCCGCCAGCCACCC
TGCCGGACTCGGGCGCGACCTGCTGGCGCGCGCCGGATGTTTCTGTGACACACAATCAGC
GCGGACCGCAGCGCGGCCCAGCCCCGGGCACCCGCCTCGGACGCTCGGGCGCCAGGAGGC
TTCGCTGGAGGGGCTGGGCCAAGGAGATTAAGAAGAAAACGACTTTCTGCAGGAGGAAGA
GCCCGCTGCCGAATCCCTGGGAAAAATTCTTTTCCCCCAGTGCCAGCCGGACTGCCCTCG
CCTTCCGGGTGTGCCCTGTCCCAGAAGATGGAATGGGGGTGTGGGGGTCCGGCTCTAGGA
ACGGGCTTTGGGGGCGTCAGGTCTTTCCAAGGTTGGGACCCAAGGATCGGGGGGCCCAGC
AGCCCGCACCGATCGAGCCGGACTCTCGGCTCTTCACTGCTCCTCCTGGCCTGCCTAGTT
CCCCAGGGCCCGGCACCTCCTGCTGCGAGACCCGGCTCTCAGCCCTGCCTTGCCCCTACC
TCAGCGTCTCTTCCACCTGCTGGCCTCCCAGTTTCCCCTCCTGCCAGTCCTTCGCCTGTC
CCTTGACGCCCTGCATCCTCCTCCCTGACTCGCAGCCCCATCGGACGCTCTCCCGGGACC
GCCGCAGGACCAGTTTCCATAGACTGCGGACTGGGGTCTTCCTCCAGCAGTTACTTGATG
CCCCCTCCCCCGACACAGACTCTCAATCTGCCGGTGGTAAGAACCGGTTCTGAGCTGGCG
TCTGAGCTGCTGCGGGGTGGAAGTGGGGGGCTGCCCACTCCACTCCTCCCATCCCCTCCC
AGCCTCCTCCTCCGGCAGGAACTGAACAGAACCACAAAAAGTCTACATTTATTTAATATG
ATGGTCTTTGCAAAAAGGAACAAAACAACACAAAAGCCCACCAGGCTGCTGCTTTGTGGA
AAGACGGTGTGTGTCGTGTGAAGGCGAAACCCGGTGTACATAACCCCTCCCCCTCCGCCC
CGCCCCGCCCGGCCCCGTAGAGTCCCTGTCGCCCGCCGGCCCTGCCTGTAGATACGCCCC
GCTGTCTGTGCTGTGAGAGTCGCCGCTCGCTGGGGGGGAAGGGGGGGACACAGCTACACG
CCCATTAAAGCACAGCACGTCCTGGGGGAGGGGGGCATTTTTTATGTTACAAAAAAAAAT
TACGAAAGAAAAGAAATCTCTATGCAAAATGACGAACATGGTCCTGTGGACTCCTCTGGC
CTGTTTTGTTGGCTCTTTCTCTGTAATTCCGTGTTTTCGCTTTTTCCTCCCTGCCCCTCT
CTCCCTCTGCCCCTCTCTCCTCTCCGCTTCTCTCCCCCTCTGTCTCTGTCTCTCTCCGTC
TCTGTCGCTCTTGTCTGTCTGTCTCTGCTCTTTCCTCGGCCTCTCTCCCCAGACCTGGCC
CGGCCGCCCTGTCTCCGCAGGCTAGATCCGAGGTGGCAGCTCCAGCCCCCGGGCTCGCCC
CCTCGCGGGCGTGCCCCGCGCGCCCCGGGCGGCCGAAGGCCGGGCCGCCCCGTCCCGCCC
CGTAGTTGCTCTTTCGGTAGTGGCGATGCGCCCTGCATGTCTCCTCACCCGTGGATCGTG
ACGACTCGAAATAACAGAAACAAAGTCAATAAAGTGAAAATAAATAAAAATCCTTGAACA
AATCCGAAAAGGCTTGGAGTCCTCGCCCAGATCTCTCTCCCCTGCGAGCCCTTTTTATTT
GAGAAGGAAAAAGAGAAAAGAGAATCGTTTAAGGGAACCCGGCGCCCAGCCAGGCTCCAG
TGGCCCGAACGGGGCGGCGAGGGCGGCGAGGGCGCCGAGGTCCGGCCCATCCCAGTCCTG
TGGGGCTGGCCGGGCAGAGACCCCGGACCCAGGCCCAGGCCTAACCTGCTAAATGTCCCC
GGACGGTTCTGGTCTCCTCGGCCACTTTCAGTGCGTCGGTTCGTTTTGATTCTTTTTCTT
TTGTGCACATAAGAAATAAATAATAATAATAAATAAAGAATAAAATTTTGTATGTCA

Protein Sequence

>5076 : length: 431
MDMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRV
SHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLA
EGICDNDTVPSVSSINRIIRTKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASND
PVGSYSINGILGIPRSNGEKRKRDEVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVPNGDS
QSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGL
DEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAG
MVPGSEFSGNPYSHPQYTAYNEAWRFSNPALLMPPPGPPLPLLPLPMTATSYRGDHIKLQ
ADSFGLHIVPV