ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5058

Name

PAK1

Synonym

PAKalpha;p21 protein (Cdc42/Rac)-activated kinase 1;PAK1;p21 protein (Cdc42/Rac)-activated kinase 1

Definition

STE20 homolog, yeast|alpha-PAK|p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast)|p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related)|p65-PAK|serine/threonine-protein kinase PAK 1

Position

11q13-q14

Gene Type

protein-coding

Pathways and Diseases

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

Regulation of p38-alpha and p38-beta;PID Curated;200054

Pathway

ras-independent pathway in nk cell-mediated cytotoxicity;PID BioCarta;100095

Pathway

role of pi3k subunit p85 in regulation of actin organization and cell migration;PID BioCarta;100211

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Angiogenesis;PANTHER;P00005

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

Axon guidance mediated by semaphorins;PANTHER;P00007

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

EGF receptor (ErbB1) signaling pathway;PID Curated;200085

Pathway

T cell activation;PANTHER;P00053

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

PLK1 signaling events;PID Curated;200087

Pathway

CDC42 signaling events;PID Curated;200057

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

EPHA2 forward signaling;PID Curated;200185

Pathway

Signal transduction by L1;PID Reactome;500100

Pathway

fas signaling pathway (cd95);PID BioCarta;100167

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

S1P2 pathway;PID Curated;200181

Pathway

links between pyk2 and map kinases;PID BioCarta;100057

Pathway

angiotensin ii mediated activation of jnk pathway via pyk2 dependent signaling;PID BioCarta;100236

Pathway

rac1 cell motility signaling pathway;PID BioCarta;100056

Pathway

fmlp induced chemokine gene expression in hmc-1 cells;PID BioCarta;100162

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

Aurora A signaling;PID Curated;200166

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

RAC1 signaling pathway;PID Curated;200190

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

EPHB forward signaling;PID Curated;200041

Pathway

Cytoskeletal regulation by Rho GTPase;PANTHER;P00016

Pathway

Netrin-mediated signaling;PID Curated;200074

Disease

Intraocular melanoma;FunDO

Disease

Renal Cell cancer;FunDO

Disease

Virus disease;FunDO

Disease

esophageal cancer;GAD

Disease

Embryoma;FunDO

Disease

Ovarian cancer;FunDO

Disease

CANCER;GAD

Disease

Dental plaque;FunDO

Disease

Breast cancer;FunDO

Disease

Alzheimer's disease;FunDO

Disease

Down syndrome;FunDO

External Links

Links to cell senescence gene database

5058

Links to epithelial mesenchymal transition gene database

5058

Links to ovarian cancer gene database

5058

Links to endometrial cancer gene database

5058

Links to iHOP

5058

Sequence Information

Nucleotide Sequence

>5058 : length: 3940
TGCCCTCCCGCGGCTGCAGCCGGAGCCGAAGGTGGTGGCTGCACAGTAGACGCCCCCTCA
CGGCTTCCCCCACACGCTCCCGCCCCCTCGCTCGCCCATCGCGCTTCCCTCACAGGCTCT
GCAGTCCTCCCCCACAGACGCCTTCCCCCTTGGACTCTCATTCCCTTTTCCACGGAGCCC
CGCGCTTTCGTGAGCCCCCTCGAGGAACCTGGTCTCCGCATCCAGTTACCACCTCCTGCC
TCAGAGGCCATCTGAGCCCTTCGCACCTCGCCCCTCAGTCCCCCCTTCCCCCCCCGCCCG
CGTCGCCTCGCTCCCTCCCGCCCCCCCATCATCCCTTCCCTCGCAGTTCCCCTGTCCTGA
GGGGAGCCCCGCCACGGGCAGCGCGGCGGCGGCGGCAGGAGGGAGAAAGTGAAGCGGTAG
CTCGCGCACACTCGCGCCCTCACTCCCGGCTAGGCGGCACCCACCGCCGGGAGGAGGAGG
AGGAGCCGAGAGGAGCTGAGCGAGCGCGGAAGCTGCTGCTGGTGGTGACAATGTCAAATA
ACGGCCTAGACATTCAAGACAAACCCCCAGCCCCTCCGATGAGAAATACCAGCACTATGA
TTGGAGCCGGCAGCAAAGATGCTGGAACCCTAAACCATGGTTCTAAACCTCTGCCTCCAA
ACCCAGAGGAGAAGAAAAAGAAGGACCGATTTTACCGATCCATTTTACCTGGAGATAAAA
CAAATAAAAAGAAAGAGAAAGAGCGGCCAGAGATTTCTCTCCCTTCAGATTTTGAACACA
CAATTCATGTCGGTTTTGATGCTGTCACAGGGGAGTTTACGGGAATGCCAGAGCAGTGGG
CCCGCTTGCTTCAGACATCAAATATCACTAAGTCGGAGCAGAAGAAAAACCCGCAGGCTG
TTCTGGATGTGTTGGAGTTTTACAACTCGAAGAAGACATCCAACAGCCAGAAATACATGA
GCTTTACAGATAAGTCAGCTGAGGATTACAATTCTTCTAATGCCTTGAATGTGAAGGCTG
TGTCTGAGACTCCTGCAGTGCCACCAGTTTCAGAAGATGAGGATGATGATGATGATGATG
CTACCCCACCACCAGTGATTGCTCCACGCCCAGAGCACACAAAATCTGTATACACACGGT
CTGTGATTGAACCACTTCCTGTCACTCCAACTCGGGACGTGGCTACATCTCCCATTTCAC
CTACTGAAAATAACACCACTCCACCAGATGCTTTGACCCGGAATACTGAGAAGCAGAAGA
AGAAGCCTAAAATGTCTGATGAGGAGATCTTGGAGAAATTACGAAGCATAGTGAGTGTGG
GCGATCCTAAGAAGAAATATACACGGTTTGAGAAGATTGGACAAGGTGCTTCAGGCACCG
TGTACACAGCAATGGATGTGGCCACAGGACAGGAGGTGGCCATTAAGCAGATGAATCTTC
AGCAGCAGCCCAAGAAAGAGCTGATTATTAATGAGATCCTGGTCATGAGGGAAAACAAGA
ACCCAAACATTGTGAATTACTTGGACAGTTACCTCGTGGGAGATGAGCTGTGGGTTGTTA
TGGAATACTTGGCTGGAGGCTCCTTGACAGATGTGGTGACAGAAACTTGCATGGATGAAG
GCCAAATTGCAGCTGTGTGCCGTGAGTGTCTGCAGGCTCTGGAGTTCTTGCATTCGAACC
AGGTCATTCACAGAGACATCAAGAGTGACAATATTCTGTTGGGAATGGATGGCTCTGTCA
AGCTAACTGACTTTGGATTCTGTGCACAGATAACCCCAGAGCAGAGCAAACGGAGCACCA
TGGTAGGAACCCCATACTGGATGGCACCAGAGGTTGTGACACGAAAGGCCTATGGGCCCA
AGGTTGACATCTGGTCCCTGGGCATCATGGCCATCGAAATGATTGAAGGGGAGCCTCCAT
ACCTCAATGAAAACCCTCTGAGAGCCTTGTACCTCATTGCCACCAATGGGACCCCAGAAC
TTCAGAACCCAGAGAAGCTGTCAGCTATCTTCCGGGACTTTCTGAACCGCTGTCTCGAGA
TGGATGTGGAGAAGAGAGGTTCAGCTAAAGAGCTGCTACAGGTGAGAAAACTGAGGTTTC
AAGTGTTTAGTAACTTTTCCATGATAGCTGCATCAATTCCTGAAGATTGCCAAGCCCCTC
TCCAGCCTCACTCCACTGATTGCTGCAGCTAAGGAGGCAACAAAGAACAATCACTAAAAC
CACACTCACCCCAGCCTCATTGTGCCAAGCCTTCTGTGAGATAAATGCACATTTCAGAAA
TTCCAACTCCTGATGCCCTCTTCTCCTTGCCTTGCTTCTCCCATTTCCTGATCTAGCACT
CCTCAAGACTTTGATCCTTGGAAACCGTGTGTCCAGCATTGAAGAGAACTGCAACTGAAT
GACTAATCAGATGATGGCCATTTCTAAATAAGGAATTTCCTCCCAATTCATGGATATGAG
GGTGGTTTATGATTAAGGGTTTATATAAATAAATGTTTCTAGTCTTCCGTGTGTCAAAAT
CCTCACCTCCTTCATAACCATCTCCCACAATTAATTCTTGACTATATAAATTTATGGTTT
GATAATATTATCAATTTGTAATCAATTGAGATTTCTTTAGTGCTTGCTTTTCTGTGACTC
AACTGCCCAGACACCTCATTGTACTTGAAAACTGGAACAGCTTGGGAATGCCATGGGGTT
TGATAATCTGCCAGGGACATGAAGAGGCTCAGCTTCCTGGACCATGACTTTGGCTCAGCT
GATCCTGACATGGGAGAACAACCACATTTTTCTTTGTGTGTGCTTCTAGCAGCTGTTCGG
GAGGACCTTGACCCAATAGTGTTCCCATGCTGTTTCTTGTGAAATGCTCTCGGCTATGTA
GCAGCTTTTGATTCCCTGCATACCCTAGGCTGCTGCCCCTATCCTGTCCCTTGTTTATAA
CATTGAGAGGTTTTCTAGGGCACATACTGAGTGAGAGCAGTGTTGAGAAGTCGGGGAAAA
TGGTGACTACTTTTAGAGCAAGGCTGGGCATCAGCACCTGTCCAGCTCTACTTGTGTGAT
GTTTCAGGAACTCAGCCCCTTTTTCTGCCTAGGATAAGGAGCTGAAAGATTAACTTGGAT
CTTCTAATGGTCCAAATCTTTTGGTCACAATAAAGAGTCTCCAAATTAGAGACTGCATGT
TAGTTCTGGATGGATTTGGTGGCCTGACATGATACCCTGCCAGCTGTGAGGGGACCCCGT
TTTTAAGATGCATGGCCAAGCTCTCTGCAAATGGAAATGCTTACACTGGGTGTTGGGGAT
GTTTGCTACCTCCTGCTATTTTTGTGGTTTTGGTTCTCCCACTATGGTAGGACCCCTGGC
CAGCATTGTGGCTTGTCATGTCAGCCCCATTGACTACCTTCTCATGCTCTGAGGTACTAC
TGCCTCTGCAGCACAAATTTCTATTTCTGTCAATAAAAGGAGATGAAAATATTCTATTGG
AGTATGCCTTTCTTTTTTCTCTTCGTTTTTTCTTTCCTTTTCTAATTTTTTATATGAAAT
AATGAGTAGTTTCTTCCTGAACCATTTGAGAGTGGTAAGTTGCAGATAGAATGCCCCTTT
ACCACTATATACCTGAATGTGTATTCTTTCTTTTTAACACTTTTATTTTAAATATAAATT
AAGAGAAATGGGCCAAAACCATTTGTATTGTTTAAAGAATAATTATAAACACACTTGTAT
CCACCAAATCAAGAAATGGAACACTGACAGTAAGAACCTTCTCTATCTTGTCCTTCCTTT
CTCATTATAGCCCCCACCTAAGAGGTAACCACCATCTTGACTTTTATTTAAATAACTTTC
TTGCTTTTCTGTATACTTTCATCACATTCAGGTGTGTTCCAATACAAGTAGATTTTAGTT
CGGCCAGTTTTTGAACTTTAAATAAACATATCATAATAGA

Protein Sequence

>5058 : length: 553
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTE
KQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQ
MNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC
MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNG
TPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQVRKLRFQVFSNFSMIAASIPEDC
QAPLQPHSTDCCS