ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5036

Name

PA2G4

Synonym

EBP1|HG4-1|p38-2G4;proliferation-associated 2G4, 38kDa;PA2G4;proliferation-associated 2G4, 38kDa

Definition

ErbB-3 binding protein 1|ErbB3-binding protein Ebp1|cell cycle protein p38-2G4 homolog|erbB3-binding protein 1|proliferation-associated 2G4, 38kD|proliferation-associated protein 2G4

Position

12q13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

5036

Links to epithelial mesenchymal transition gene database

5036

Links to ovarian cancer gene database

5036

Links to endometrial cancer gene database

5036

Links to iHOP

5036

Sequence Information

Nucleotide Sequence

>5036 : length: 2643
GTTTTTCCGGGAGAGACCACGCTTCCCCTCAAGCTCCCCAACGGCTCCGCCTTCCCGCCG
GAGCCTGACCCTTCCCAGAGTGCCCGGCGATTCCGGCGTGCGAGGCCCTTGGAGGGCAAG
GCCCCAGGGCCTGGCTTAGGAGCGCGAGAGGCAGGCTGGGAATTGTAGTTCGAAGGCCCT
CGAGAGCGGCTAGAGTCTGGCGGCCGAGAGGACTAGTTGTCCCAGCGTGCCCTGCGCCTC
AGCCCGCGCGCTCGCAGCTTCTCGCTCTCGCCTGCCTGCCCGCTCCCTTGCTTGCTCGCG
CTTTCGCTCGCCCTCTCCTCGAGGATCGAGGGGACTCTGACCACAGCCTGTGGCTGGGAA
GGGAGACAGAGGCGGCGGCGGCTCAGGGGAAACGAGGCTGCAGTGGTGGTAGTAGGAAGA
TGTCGGGCGAGGACGAGCAACAGGAGCAAACTATCGCTGAGGACCTGGTCGTGACCAAGT
ATAAGATGGGGGGCGACATCGCCAACAGGGTACTTCGGTCCTTGGTGGAAGCATCTAGCT
CAGGTGTGTCGGTACTGAGCCTGTGTGAGAAAGGTGATGCCATGATTATGGAAGAAACAG
GGAAAATCTTCAAGAAAGAAAAGGAAATGAAGAAAGGTATTGCTTTTCCCACCAGCATTT
CGGTAAATAACTGTGTATGTCACTTCTCCCCTTTGAAGAGCGACCAGGATTATATTCTCA
AGGAAGGTGACTTGGTAAAAATTGACCTTGGGGTCCATGTGGATGGCTTCATCGCTAATG
TAGCTCACACTTTTGTGGTTGATGTAGCTCAGGGGACCCAAGTAACAGGGAGGAAAGCAG
ATGTTATTAAGGCAGCTCACCTTTGTGCTGAAGCTGCCCTACGCCTGGTCAAACCTGGAA
ATCAGAACACACAAGTGACAGAAGCCTGGAACAAAGTTGCCCACTCATTTAACTGCACGC
CAATAGAAGGTATGCTGTCACACCAGTTGAAGCAGCATGTCATCGATGGAGAAAAAACCA
TTATCCAGAATCCCACAGACCAGCAGAAGAAGGACCATGAAAAAGCTGAATTTGAGGTAC
ATGAAGTATATGCTGTGGATGTTCTCGTCAGCTCAGGAGAGGGCAAGGCCAAGGATGCAG
GACAGAGAACCACTATTTACAAACGAGACCCCTCTAAACAGTATGGACTGAAAATGAAAA
CTTCACGTGCCTTCTTCAGTGAGGTGGAAAGGCGTTTTGATGCCATGCCGTTTACTTTAA
GAGCATTTGAAGATGAGAAGAAGGCTCGGATGGGTGTGGTGGAGTGCGCCAAACATGAAC
TGCTGCAACCATTTAATGTTCTCTATGAGAAGGAGGGTGAATTTGTTGCCCAGTTTAAAT
TTACAGTTCTGCTCATGCCCAATGGCCCCATGCGGATAACCAGTGGTCCCTTCGAGCCTG
ACCTCTACAAGTCTGAGATGGAGGTCCAGGATGCAGAGCTAAAGGCCCTCCTCCAGAGTT
CTGCAAGTCGAAAAACCCAGAAAAAGAAAAAAAAGAAGGCCTCCAAGACTGCAGAGAATG
CCACCAGTGGGGAAACATTAGAAGAAAATGAAGCTGGGGACTGAGGTGGGTCCCATCTCC
CCAGCTTGCTGCTCCTGCCTCATCCCCTTCCCACCAAACCCCAGACTCTGTGAAGTGCAG
TTCTTCTCCACCTAGGACCGCCAGCAGAGCGGGGGGATCTCCCTGCCCCCACCCCAGTTC
CCCAACCCACTCCCTTCCAACAACAACCAGCTCCAACTGACTCTGGTCTTGGGAGGTGAG
GCTTCCCAACCACGGAAGACTACTTTAAATGAAAAAAAGAAATTGAATAATAAAATCAGG
AGTCAAAATTCATCGTCTTCAAGCCCCTCTTTCTAGCCTTTTCTACTACTCTCTGCTTGG
TCAAGGTTTGTGCCCCACTACAGAACAGGGCTAAATTAGCCACCACCACTGAAAACTCAG
CCGAATTTTTTTATACCACTCTGATGTCAGCATTTTTTCCATCTGTTTGGGGCTTTTTCC
TCTTTTTTCCATTCTCCCCAAATATTTTATCTGGCTTCAAAATTAAGAGGATTATTTTTC
AGATTGTTTTTATTCAGTGTGGCCGATTCCTCATCTGATTCAGGCTGTCCAGTCAGGCCC
CTCCCATTTTAGGAGCTGGAGCCTTCATTTATGAAGAGATTCTCATCTATGAAATGGATC
CTCATTTGTAAATCTTTTTTCTTCCATTTTCACAAAGCTGTAAAGAAATAATCCATCTCA
ACCTTACCCTTTTTCTCTGGAGTCAGTGGGGTCTTTCCTCGCTCCATCTTACACAGACCT
GAGCTGGAAGCTCAACTGGTTTTGTTCCCTGTTTGAAATATTGTGATCTCCCTCCCATGA
AAGAAAAACCAAGAACCAGAGGCGTAGACTGACTGAAGACACAACTCCTGGCTTTCTGAA
GCTATGGACTTGGATTGGATTGCTGGGGGTTTGTAGAGAAAGGTGACAAATTTCAGTACC
TCTGGCATGCTGTCCCAGGAAACTAGGGCTCCCACTAACTTATGAGGTTTTTAAACACAT
TGAAAATGACATGACATTAAAATAAATTTGGATTTGCTCATAATGAAAAAAAAAAAAAAA
AAA

Protein Sequence

>5036 : length: 394
MSGEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEET
GKIFKKEKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIAN
VAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCT
PIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDA
GQRTTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHE
LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQS
SASRKTQKKKKKKASKTAENATSGETLEENEAGD