ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

5015

Name

OTX2

Synonym

CPHD6|MCOPS5;orthodenticle homeobox 2;OTX2;orthodenticle homeobox 2

Definition

homeobox protein OTX2|orthodenticle homolog 2

Position

14q22.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

5015

Links to epithelial mesenchymal transition gene database

5015

Links to ovarian cancer gene database

5015

Links to endometrial cancer gene database

5015

Links to iHOP

5015

Sequence Information

Nucleotide Sequence

>5015 : length: 2348
AAATCTCCCTGAGAGCGGGACCGGCCTCAGCTCCAACACAGCCTCCACTGTGATTAAAAA
TAAAAATTGCTAGAGCAGCCCTCACTCGCCACATCTACTTTGTATGTATTGCAGAGGGGC
CCACGCGTGTTTAGAACTCTAGCCGCCTTCCTCATTTTCGTTCTTTAAAAAAAATTTTTT
TTGGTTGTGTTTGACTTTTCATGGAAGGGTGAAGACTGCAAGGTTTCTAACTCAATACTC
TTGATTTCTTTTAGGATAGCTGGCTATTTGGAATTTAAAGGATATTTGACTTTTTCTAAC
CTCCCATGAGGCTGTAAGTTCCACTGCTCCAAACCCACCCACCAAGGACTCTGAACCTGT
CCACCCCGGGCGCATCAAGATCTTCCAGCTGGGTACCCCCGATTTGGGCCGACTTTGCAC
CTCCAAACAACCTTAGCATGATGTCTTATCTTAAGCAACCGCCTTACGCAGTCAATGGGC
TGAGTCTGACCACTTCGGGTATGGACTTGCTGCACCCCTCCGTGGGCTACCCGGCCACCC
CCCGGAAACAGCGCCGGGAGAGGACGACGTTCACTCGGGCGCAGCTAGATGTGCTGGAAG
CACTGTTTGCCAAGACCCGGTACCCAGACATCTTCATGCGAGAGGAGGTGGCACTGAAAA
TCAACTTGCCCGAGTCGAGGGTGCAGGTATGGTTTAAGAATCGAAGAGCTAAGTGCCGCC
AACAACAGCAACAACAGCAGAATGGAGGTCAAAACAAAGTGAGACCTGCCAAAAAGAAGA
CATCTCCAGCTCGGGAAGTGAGTTCAGAGAGTGGAACAAGTGGCCAATTCACTCCCCCCT
CTAGCACCTCAGTCCCGACCATTGCCAGCAGCAGTGCTCCTGTGTCTATCTGGAGCCCAG
CTTCCATCTCCCCACTGTCAGATCCCTTGTCCACCTCCTCTTCCTGCATGCAGAGGTCCT
ATCCCATGACCTATACTCAGGCTTCAGGTTATAGTCAAGGATATGCTGGCTCAACTTCCT
ACTTTGGGGGCATGGACTGTGGATCATATTTGACCCCTATGCATCACCAGCTTCCCGGAC
CAGGGGCCACACTCAGTCCCATGGGTACCAATGCAGTCACCAGCCATCTCAATCAGTCCC
CAGCTTCTCTTTCCACCCAGGGATATGGAGCTTCAAGCTTGGGTTTTAACTCAACCACTG
ATTGCTTGGATTATAAGGACCAAACTGCCTCCTGGAAGCTTAACTTCAATGCTGACTGCT
TGGATTATAAAGATCAGACATCCTCGTGGAAATTCCAGGTTTTGTGAAGACCTGTAGAAC
CTCTTTTTGTGGGTGATTTTTAAATATACTGGGCTGGACATTCCAGTTTTAGCCAGGCAT
TGGTTAAAAGAGTTAGATGGGATGATGCTCAGACTCATCTGATCAAAGTTCCGAGAGGCA
TAGAAGGAAAAACGAAGGGCCTTAGAGGGGCCTACAAACCAGCAACATGAAATGGACAAA
CCAATCTGCTTAAGATCCTGTCATAGTTTTAGATCATTGGTTATCCTGATTTGCAAAGTG
ATCAAAAGCATTCTAGCCATGTGCAACCAAACACCACCAAAAATAAAATCAAACAAAACT
AAGTTGTGAAGGAAGGGAGGGAAGGTCATAGCCTTCTTAAGCAGAGGTGTTCCATTGTTT
TAGCCAATCCTTGGTTGAATCTTAGGAATGAACAGTGTCTCAAGCTCATTCACGTTTCAT
GACCAACTGGTAGTTGGCACTGAAAAAACTTTTCAGGGCTGTGTGAATTGTGTGACTGAT
TGTCCTAGATGCACTACTTTATTTAAAAAATAATGTTCATAAGGAGTCAATATGTAGTTT
AAGAGACAATCAGTGTGTGTCTTATAAATGGTACATCTGTGGTTTTTAATCTGTGCTAGA
CTTCAAAACTGTGATCTCCTGTTATTGTATGCAACCTTGAACTCCACCTCTGCAGGGGTT
CTTCTGTGATTAAATAGGTTATAATTATAAGCAAAATTCAGAGCAACTGAGTACTGATCT
AAAAAGATTACCTTTGGCTGGAGGTGAGCTGCACTGAAACTTTACGACAAAATGTCTCTG
GACAAAGAGAGTCAGAGAAGAGAAGCAAAAGGACACTAATTCATCTGTAATTTACTGTTG
GTAAGCCTAGCAGTAAAGAGACATTGGTCAATTGCTCTGACCCTGATGAATTATTAAACT
GAGATCATTGTCGTTTATGCTTGCAGATGTTAAATGGAAAAGTTATATATGCATAAACCT
TTTCTTCCTGGATTTGGCAGATATGTATAATTATATTAAAATGGTTCTAGCACAAAAAAA
AAAAAAAA

Protein Sequence

>5015 : length: 297
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDV
LEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAK
KKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQ
RSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLN
QSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL