ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4973

Name

OLR1

Synonym

CLEC8A|LOX1|LOXIN|SCARE1|SLOX1;oxidized low density lipoprotein (lectin-like) receptor 1;OLR1;oxidized low density lipoprotein (lectin-like) receptor 1

Definition

C-type lectin domain family 8 member A|hLOX-1|lectin-type oxidized LDL receptor 1|ox LDL receptor 1|oxidized low-density lipoprotein receptor 1|oxidized low-density lipoprotein receptor 1, soluble form|scavenger receptor class E, member 1

Position

12p13.2-p12.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

PPAR signaling pathway;KEGG PATHWAY;hsa03320

Pathway

Cell surface interactions at the vascular wall;PID Reactome;500305

Pathway

Phagosome;KEGG PATHWAY;hsa04145

Pathway

Hemostasis;Reactome;REACT:604

Disease

atherosclerosis, coronary;GAD

Disease

CARDIOVASCULAR;GAD

Disease

Edema rosiglitazone or pioglitazone;GAD

Disease

Myocardial infarction, susceptibility to;OMIM

Disease

PHARMACOGENOMIC;GAD

Disease

Myocardial Infarction;GAD

Disease

Atherosclerosis;GAD

Disease

C-reactive protein cardiovascular event lipids;GAD

Disease

myocardial infarct;GAD

Disease

Alzheimer's disease;GAD

Disease

NEUROLOGICAL;GAD

External Links

Links to cell senescence gene database

4973

Links to epithelial mesenchymal transition gene database

4973

Links to ovarian cancer gene database

4973

Links to endometrial cancer gene database

4973

Links to iHOP

4973

Sequence Information

Nucleotide Sequence

>4973 : length: 2540
AATGAGATTATGCCTTGGGGCAGCTTTAACTCTGAATCCTGTCCCTAACCAAGCCTCCAT
ATAGGGAATGATGAAAGAAGAAAGATAATTCAGACAAGAAGACTGAACGAAGTACACTTT
GGACAGCTTGAATTTGGAAATGACTTTTGATGACCTAAAGATCCAGACTGTGAAGGACCA
GCCTGATGAGAAGTCAAATGGAAAAAAAGCTAAAGGTCTTCAGTTTCTTTACTCTCCATG
GTGGTGCCTGGCTGCTGCGACTCTAGGGGTCCTTTGCCTGGGATTAGTAGTGACCATTAT
GGTGCTGGGCATGCAATTATCCCAGGTGTCTGACCTCCTAACACAAGAGCAAGCAAACCT
AACTCACCAGAAAAAGAAACTGGAGGGACAGATCTCAGCCCGGCAACAAGCAGAAGAAGC
TTCACAGGAGTCAGAAAACGAACTCAAGGAAATGATAGAAACCCTTGCTCGGAAGCTGAA
TGAGAAATCCAAAGAGCAAATGGAACTTCACCACCAGAATCTGAATCTCCAAGAAACACT
GAAGAGAGTAGCAAATTGTTCAGCTCCTTGTCCGCAAGACTGGATCTGGCATGGAGAAAA
CTGTTACCTATTTTCCTCGGGCTCATTTAACTGGGAAAAGAGCCAAGAGAAGTGCTTGTC
TTTGGATGCCAAGTTGCTGAAAATTAATAGCACAGCTGATCTGGACTTCATCCAGCAAGC
AATTTCCTATTCCAGTTTTCCATTCTGGATGGGGCTGTCTCGGAGGAACCCCAGCTACCC
ATGGCTCTGGGAGGACGGTTCTCCTTTGATGCCCCACTTATTTAGAGTCCGAGGCGCTGT
CTCCCAGACATACCCTTCAGGTACCTGTGCATATATACAACGAGGAGCTGTTTATGCGGA
AAACTGCATTTTAGCTGCCTTCAGTATATGTCAGAAGAAGGCAAACCTAAGAGCACAGTG
AATTTGAAGGCTCTGGAAGAAAAGAAAAAAGTCTTTGAGTTTTATTCTGGAATTTAAGCT
ATTCTTTGTCACTTGGGTGCCAAACATGAGAGCCCAGAAAACTGTCATTTAGCTGGCTGC
AGAACTCCTTTGCAGAAACTGGGGTTCCAGGAGCCTGGCACCTTTATGTCAACATTTTTG
ATTCTAGCTACCTGTATTATTTCACCTAGCTTGTCCCAAGCTTCCCTGCCAGCCTGAAGT
CCATTTTCCCCTTTTTATTTTAAAATTTGACTCCTCTTCAAGCTTGAAAACCCTCTGAAC
TCAGTCTTCTTTACCTCATTATCACCTTCCCCTCACACTCCTAAAATTGCATGAAAGACA
GAACATGGAGAACTTGCTCAAGTGCAGGCAGAGAGCAAAAAGGGGAAATATGTCTGGGAA
AAAGTGCACGTGAAGAAACAAAGAAGGACAGAGGCCATTCCGAAATCAAGAAACTCATGT
TCTTAACTTTAAAAAAGGTATCAATCCTTGGTTTTTAAACTGTGGTCCATCTCCAGACTC
TACCACTTACGGACAGACAGACAGACAGACACACACACACACACACACACACATTTTGGG
ACAAGTGGGGAGCCCAAGAAAGTAATTAGTAAGTGAGTGGTCTTTTCTGTAAGCTAATCC
ACAACCTGTTACCACTTCCTGAATCAGTTATTATTTCTTCATTTTTTTTTCTACCAGAGG
ACAGATTAATAGATTTAACCCTTCACAACAGTTCTTGTTAGAATCATGGGATGTGTGGCC
CAGAGGTAAGAATAGAATTTCTTTCCCTAAAGAACATACCTTTTGTAGATGAACTCTTCT
CAACTCTGTTTTGCTATGCTATAATTCCGAAACATACAAGACAAAAAAAATGAAGACACT
CAATCTAGAACAAACTAAGCCAGGTATGCAAATATCGCTGAATAGAAACAGATGGAATTA
GAAATATATCTTCTATTTTTAGGCTTCTATTTCCTTTCCACCCACTCTTCACAGGCTATT
CTACTTTAAAGGAAGCCTTTTTATTTTGCTGCACACAATCTAGCAGGAATCTTTTTTTTT
TTTTAAGAGCTGTGTCATCCTTATGTAGGCAAGAGATGTTTGCTTTTGTTAAAAGCTTTA
TTGAGATATAATTAACATAAAATAAACTGAACATATTTAAAGTGTACTATTTGATAAGTT
TTCACACCTTGTGGAGAACATGCATACTACAATTAAGAGAGTGAACATATCCATCATCCC
TCAAAGTGTCACAATGCTCCTCCTGATGACTCCTCCCCAGAAAACCACCAATCGGCTTTC
ATTTTGCATTTTGTAGTTTTATGTGAATGGAATCATATAGTATGTCTTTTTTTTTTGTCT
GGCTTCTTTCACTTTGCATAATTATTTTGAGATTCATATGTCTCCATCTTGATGCTCGTA
TGAATTCATTCTTTTAAATGTTGAATATTCCCTTGTATGGATATACCACAATTCATTTAC
CCATTTACTTGTTGATGACATTTGGGTTGTTTTAGTTTTGGGATATTACAAATAAAGCTG
CTGTGAACATTTGTGTACAA

Protein Sequence

>4973 : length: 273
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQL
SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQ
MELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLL
KINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPS
GTCAYIQRGAVYAENCILAAFSICQKKANLRAQ