ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4928

Name

NUP98

Synonym

ADIR2|NUP196|NUP96;nucleoporin 98kDa;NUP98;nucleoporin 98kDa

Definition

GLFG-repeat containing nucleoporin|Nup98-Nup96|nuclear pore complex protein Nup98-Nup96|nucleoporin 98kD

Position

11p15.5

Gene Type

protein-coding

Pathways and Diseases

Pathway

Metabolism of carbohydrates;Reactome;REACT:474

Pathway

HIV Infection;Reactome;REACT:6185

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

Transmembrane transport of small molecules;Reactome;REACT:15518

Pathway

DNA Replication;Reactome;REACT:383

Disease

Leukemia, lymphocytic, acute T-cell;OMIM

External Links

Links to cell senescence gene database

4928

Links to epithelial mesenchymal transition gene database

4928

Links to ovarian cancer gene database

4928

Links to endometrial cancer gene database

4928

Links to iHOP

4928

Sequence Information

Nucleotide Sequence

>4928 : length: 7076
GGTAAGTCGGGAGCCCGAGCTGCAGCGGCCGAGACCGGCAGGTTTCTCCCCCCTTCCGGG
CGGGCGGACGCGCGGGGCGTCTCAGGGCCTCTCCGCTTCGAAGTCTAGCGCCGCTGCGCG
CACCTTCTGGCCTGAGAGAGGGGCGGTGCTGAGGACCCGGGGGCCCGGAGCCCGGGAGGC
CCGGCTTTGGAGGCCCTGGGAGAGAATGGACATCAGTGGGGTCTAGGCCTGGAGGTCTCC
AGTTGCTGCCCACGCGAGTGGGTGTCTGTCTGGTTGTACTCATTCATTCAGTGGTGTAAG
GACCCCACGGTGGGCTGGCCTTTCCGGGGTCAGCGCCTTGAAACCCTGAATACGGTCTGC
CCCGCACTTCCTTGACCGTCATGTGGGACTGGGCTTTATTTGCCTTGGCTTCTCCATAAG
GGAAGTGGGCACCCCGAGGATTAGGCTTTCTGAAACAAAGACTCATTTTGAAGATGTTTA
ACAAATCATTTGGAACACCCTTTGGGGGTGGCACAGGTGGCTTTGGCACAACTTCAACAT
TTGGACAGAATACTGGCTTTGGCACTACTAGTGGAGGGGCATTTGGAACATCTGCATTTG
GTTCTAGCAACAATACTGGAGGCCTCTTTGGAAATTCACAGACTAAACCAGGAGGATTGT
TTGGAACCAGTTCATTTAGCCAGCCAGCTACCTCCACAAGCACTGGCTTTGGGTTTGGTA
CGTCAACAGGAACAGCAAATACCTTGTTTGGAACTGCAAGCACAGGGACCAGTCTCTTCT
CATCCCAAAACAATGCCTTTGCACAAAATAAACCAACTGGCTTTGGCAATTTTGGAACCA
GTACTAGCAGTGGAGGACTCTTTGGAACCACAAATACCACCTCTAATCCTTTTGGCAGCA
CATCTGGCTCCCTCTTTGGGCCAAGTAGTTTTACAGCTGCTCCTACTGGGACTACTATTA
AATTTAACCCTCCAACTGGTACAGATACTATGGTCAAAGCTGGAGTTAGCACTAACATAA
GTACCAAGCACCAGTGTATTACTGCTATGAAAGAATATGAAAGCAAGTCACTAGAGGAAC
TTCGTTTAGAGGATTATCAGGCTAACAGGAAGGGCCCACAGAACCAGGTGGGAGCAGGTA
CCACAACTGGCTTGTTTGGGTCTTCTCCAGCCACTTCCAGCGCAACAGGACTCTTCAGCT
CCTCCACCACTAATTCAGGCTTTGCATATGGTCAGAACAAAACTGCCTTTGGAACTAGTA
CAACTGGATTTGGAACAAATCCAGGTGGTCTCTTTGGCCAACAGAATCAGCAGACTACCA
GCCTCTTCAGCAAACCATTTGGCCAGGCTACAACCACCCAGAACACTGGCTTTTCCTTTG
GTAATACCAGCACCATAGGACAGCCAAGCACCAACACCATGGGATTATTTGGAGTAACCC
AAGCCTCACAGCCTGGAGGTCTTTTTGGGACAGCTACAAACACCAGCACTGGGACAGCAT
TTGGAACAGGAACAGGTCTCTTTGGGCAGACCAATACTGGATTTGGTGCTGTTGGTTCGA
CCCTGTTTGGCAATAACAAGCTTACTACATTTGGAAGCAGCACAACCAGTGCACCTTCAT
TTGGTACAACCAGTGGCGGGCTCTTTGGTAACAAACCAACCCTGACTTTAGGAACCAATA
CAAACACTTCTAATTTTGGTTTTGGCACAAATACCAGTGGGAATAGTATTTTTGGAAGTA
AACCAGCACCTGGGACTCTTGGAACTGGGCTTGGTGCAGGATTTGGAACAGCTCTTGGTG
CTGGACAGGCATCTTTGTTTGGGAACAACCAACCTAAGATTGGAGGGCCTCTTGGTACAG
GAGCCTTTGGGGCCCCTGGATTTAATACTACGACAGCCACTTTGGGCTTTGGAGCCCCCC
AGGCCCCAGTAGCTTTGACAGATCCAAATGCTTCTGCTGCCCAGCAGGCTGTTCTCCAGC
AGCACATCAATAGTCTAACATACTCACCTTTTGGAGACTCTCCTCTCTTCCGGAATCCGA
TGTCAGACCCTAAGAAGAAGGAAGAGAGATTGAAACCAACAAATCCAGCAGCCCAGAAGG
CTCTTACTACACCTACTCATTATAAACTGACACCCCGCCCTGCCACTAGAGTCCGGCCAA
AGGCTTTACAAACAACAGGCACAGCCAAGTCACATCTCTTTGATGGGCTGGATGACGATG
AACCATCCCTAGCCAATGGAGCATTCATGCCCAAGAAGAGCATTAAGAAGTTGGTTTTGA
AGAACCTTAATAATAGCAATCTCTTTTCTCCTGTTAATCGTGATTCAGAAAATCTAGCTT
CACCATCTGAATATCCAGAAAATGGAGAGAGATTTAGTTTCCTAAGCAAACCTGTTGATG
AGAATCACCAGCAGGATGGAGATGAAGATTCCCTTGTTTCACATTTTTATACTAACCCTA
TTGCCAAACCTATTCCTCAAACCCCAGAAAGTGCTGGAAATAAACACAGCAACAGCAACA
GTGTGGATGATACCATTGTTGCATTAAACATGCGTGCTGCTTTGCGAAATGGGCTGGAAG
GAAGCAGTGAAGAAACGTCTTTTCATGATGAGTCACTTCAGGATGACCGAGAAGAAATAG
AAAATAATTCTTACCATATGCACCCAGCAGGTATTATTCTCACTAAGGTTGGTTACTATA
CTATTCCATCTATGGATGACCTTGCTAAAATTACCAATGAAAAAGGAGAGTGCATTGTCT
CTGATTTCACTATTGGTCGGAAAGGTTATGGTTCAATCTATTTTGAAGGAGATGTGAATT
TGACAAATCTAAATTTGGATGATATTGTGCATATCCGGAGGAAAGAAGTAGTTGTCTACT
TAGATGATAACCAAAAACCACCTGTGGGTGAAGGGCTAAATAGGAAGGCTGAAGTTACAT
TGGATGGAGTTTGGCCAACAGATAAAACATCTCGTTGTTTAATAAAGAGCCCAGATCGCC
TTGCTGATATCAACTATGAAGGAAGATTGGAAGCAGTTTCAAGGAAACAGGGAGCTCAAT
TCAAAGAATACCGGCCTGAAACTGGTTCTTGGGTGTTTAAGGTCTCCCATTTTTCTAAGT
ATGGCCTTCAGGATTCTGATGAAGAGGAGGAGGAGCATCCGTCTAAAACTAGTACAAAGA
AGTTGAAGACTGCTCCTTTGCCTCCTGCAAGCCAGACTACGCCCTTGCAGATGGCTCTTA
ATGGCAAACCTGCACCTCCACCTCAGAGCCAGAGCCCAGAGGTGGAGCAGTTAGGGAGGG
TTGTGGAACTGGACAGTGACATGGTAGATATCACCCAGGAGCCAGTTTTGGATACCATGT
TAGAAGAGAGCATGCCTGAGGATCAGGAACCTGTGTCTGCCTCAACACATATTGCATCTT
CACTGGGAATTAATCCACATGTCTTACAGATCATGAAAGCATCATTGCTTACTGATGAAG
AAGATGTAGATATGGCACTGGATCAACGCTTCAGTCGCCTGCCTTCCAAAGCAGATACTT
CTCAAGAAATCTGTTCTCCCAGACTCCCCATTTCAGCATCCCACTCGTCGAAAACTCGTT
CACTAGTTGGTGGGTTACTACAATCAAAATTTACAAGTGGAGCTTTTCTTTCACCAAGTG
TCTCTGTGCAAGAATGTCGTACTCCCAGAGCAGCATCTTTAATGAATATCCCATCCACAT
CCTCTTGGTCTGTCCCTCCACCCCTGACTTCTGTGTTCACAATGCCCAGCCCAGCCCCTG
AGGTTCCGTTGAAAACAGTGGGTACACGTAGGCAACTAGGCCTAGTCCCTCGTGAAAAGT
CTGTCACCTATGGCAAGGGAAAACTCTTGATGGACATGGCCCTATTCATGGGACGCTCAT
TTCGTGTTGGTTGGGGCCCCAACTGGACTCTTGCTAATAGTGGAGAACAGCTGAATGGCT
CTCATGAACTAGAAAATCATCAGATTGCCGATTCCATGGAGTTTGGATTCCTGCCCAATC
CAGTAGCTGTTAAACCCCTAACTGAGTCCCCATTCAAAGTTCACTTAGAAAAACTCAGTT
TGAGACAAAGAAAGCCAGATGAAGACATGAAATTATATCAGACACCTCTGGAGCTCAAAT
TAAAACACAGCACTGTCCATGTGGATGAACTGTGTCCTCTCATTGTCCCCAATCTGGGAG
TTGCTGTCATTCATGACTATGCAGATTGGGTTAAAGAAGCATCAGGAGACTTACCAGAAG
CACAAATTGTGAAGCACTGGAGCCTGACATGGACACTATGTGAAGCCCTATGGGGCCACC
TGAAGGAGCTTGACAGCCAGCTAAATGAACCCCGTGAATACATTCAAATTCTGGAGCGAA
GAAGAGCTTTCTCCCGCTGGCTATCCTGTACTGCCACACCTCAGATTGAAGAGGAAGTCT
CCTTAACCCAAAAAAACAGCCCTGTGGAGGCTGTATTCAGCTACCTCACAGGCAAAAGGA
TCAGTGAGGCCTGCTCTCTGGCCCAGCAGTCAGGGGATCATCGTCTTGCTCTTCTTTTAT
CTCAGTTTGTGGGTAGCCAGTCAGTCCGGGAGCTGCTCACCATGCAGTTGGTGGACTGGC
ATCAGCTCCAAGCAGACTCCTTCATCCAGGATGAGAGACTGCGCATCTTTGCTCTGTTGG
CTGGAAAACCGGTGTGGCAGCTCTCAGAAAAGAAGCAAATAAACGTGTGCTCCCAGTTGG
ATTGGAAACGCTCCCTGGCTATCCATCTTTGGTATTTGCTTCCACCAACAGCCTCCATTT
CTAGGGCGCTCAGCATGTATGAAGAAGCATTTCAGAATACCTCTGACAGTGACAGATATG
CCTGCTCCCCACTTCCTTCGTATCTGGAGGGTTCTGGCTGTGTGATAGCGGAGGAGCAAA
ACTCACAGACACCACTTCGAGATGTCTGCTTTCACCTTCTAAAACTCTACAGTGACAGAC
ATTATGATCTCAACCAGCTGCTGGAGCCTCGAAGCATAACAGCAGATCCTTTGGACTACC
GCCTAAGCTGGCACTTGTGGGAAGTGCTGAGGGCTCTTAACTACACCCATCTCTCAGCGC
AGTGTGAAGGTGTGCTACAGGCCAGTTACGCTGGCCAGCTTGAAAGTGAGGGGCTCTGGG
AGTGGGCCATCTTTGTCCTCCTGCACATTGACAACTCAGGCATACGTGAGAAGGCTGTTC
GAGAGCTGCTTACCCGGCACTGCCAGCTGTTGGAGACCCCTGAATCTTGGGCTAAAGAGA
CTTTCCTTACCCAGAAGCTCCGTGTACCTGCCAAATGGATCCACGAGGCCAAAGCTGTGC
GAGCACACATGGAATCTGACAAGCACTTAGAGGCCCTTTGCTTATTTAAGGCTGAGCACT
GGAACCGCTGCCACAAGCTCATCATCCGACACTTAGCTTCTGATGCCATCATTAATGAGA
ACTATGACTACCTGAAGGGGTTCTTGGAAGACCTGGCACCTCCAGAGCGCAGCAGCCTAA
TTCAGGATTGGGAAACATCTGGGCTTGTTTACCTGGACTATATTAGAGTCATTGAAATGC
TCCGCCATATACAGCAGGTGGATTGCTCAGGTAATGACCTGGAGCAGTTACACATCAAAG
TGACTTCACTGTGCAGTCGGATAGAGCAGATTCAGTGTTACAGTGCTAAAGATCGCCTGG
CTCAGTCAGACATGGCCAAACGTGTAGCCAACCTGCTGCGCGTGGTGCTGAGTCTGCATC
ATCCTCCTGATAGAACCTCCGACTCAACACCAGACCCTCAGCGAGTCCCTTTGCGCCTCT
TGGCTCCCCACATTGGCCGGCTTCCCATGCCTGAGGACTATGCCATGGACGAACTGCGCA
GCCTTACCCAGTCCTATCTGCGAGAACTGGCTGTTGGGAGCCTGTGAGCCCCAGGCACTT
TGCATCACAGTCACATGCCCATTCACACCACACAGAGGTTCCCTGCCTTGTTTGGATTGG
CACTGTTTGCCATTCTCTGGGTTGGCTGTGGCATCTACCCTCCCTCCCTGCTGCCAGAAG
CAGCATCCTCCACTTGTTCAGGGCTTTTCTTAATACTGAACGTAGCATAAGGGCTTCTGG
AACCCAGAAGAGGAGACAGTTTACCATCCTCAAGATCATTCAGTGTTTTTCCTTTAAAAA
AATGGTCAATAAAGCTCCTTTGGCAGAATCCCCCAAAGAACCAGGGTATTCTTTTTCCAT
CCCTAGCCATTCTGGATCTTGTGACCCTCCATGCCAACCAGCTTCCCTACTCCTACCCTG
GCCCTTTTATACTAGGACTCCTTAGGAGGAGTGAGACAGGTGATAATGGATCCTTAACAG
ATGAACTATCCACAGAAGGAAGAGGGATCCGTCTCTTAAGTAATTGGTTAGTTAACACTG
AATTTTGGAGGCAAAGGAGGGTTGGCCTGAGTTAGGAAACAAAATGGGATCTTTCTGACA
CACTTAGGGCAGAAGTGAATGCCTGTCACGGAGGGATTGATCTTCAGGGCTGTTTTTGTT
CCTGCCTTTAGAGTTCCATGAACACCATACCTTTGCTACTACTATGTGCAGGAACCCTTG
GTCACATGTGACATGTCTGTGGGAAGCTCCCAGAGTTTGGTTTGGTCCCTGGTTTTCAGT
CTTGCTGAGACTCTGTCTGGATTTGCCTGCAGAGTTTGGATAAAAAATGGCAGGTTGGGT
AACCCTCCCTGTTCATCCCATGTTAGCTCCAAAGCATTTCCCACCCTCCATCTACCCCTT
CCAGAAGCAAAAACAAACCATGACTGAGGCAGGCATGGAGTTGGGCGTTAGGGGCAGGCA
GAGGGCCTTTGCTACACTGCTGACAGCTATAGGGAGCCCCAGGTAATGGCATGAGATAGC
TGGTGTTAGGGCTATCTCAGGCAATATGGCCACACCTGGGTCTTTATGCATGAAGATAAT
GTAAAGGTTTTTATTAAAAAATATATATATGTATAAATAAATGATCTAGATATTTTCCTC
TTTTTCTGAAGCTACTTTCTTAAAAAATAAATAAAATGTTTATAGCATTCCTGGTA

Protein Sequence

>4928 : length: 1817
MFNKSFGTPFGGGTGGFGTTSTFGQNTGFGTTSGGAFGTSAFGSSNNTGGLFGNSQTKPG
GLFGTSSFSQPATSTSTGFGFGTSTGTANTLFGTASTGTSLFSSQNNAFAQNKPTGFGNF
GTSTSSGGLFGTTNTTSNPFGSTSGSLFGPSSFTAAPTGTTIKFNPPTGTDTMVKAGVST
NISTKHQCITAMKEYESKSLEELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGL
FSSSTTNSGFAYGQNKTAFGTSTTGFGTNPGGLFGQQNQQTTSLFSKPFGQATTTQNTGF
SFGNTSTIGQPSTNTMGLFGVTQASQPGGLFGTATNTSTGTAFGTGTGLFGQTNTGFGAV
GSTLFGNNKLTTFGSSTTSAPSFGTTSGGLFGNKPTLTLGTNTNTSNFGFGTNTSGNSIF
GSKPAPGTLGTGLGAGFGTALGAGQASLFGNNQPKIGGPLGTGAFGAPGFNTTTATLGFG
APQAPVALTDPNASAAQQAVLQQHINSLTYSPFGDSPLFRNPMSDPKKKEERLKPTNPAA
QKALTTPTHYKLTPRPATRVRPKALQTTGTAKSHLFDGLDDDEPSLANGAFMPKKSIKKL
VLKNLNNSNLFSPVNRDSENLASPSEYPENGERFSFLSKPVDENHQQDGDEDSLVSHFYT
NPIAKPIPQTPESAGNKHSNSNSVDDTIVALNMRAALRNGLEGSSEETSFHDESLQDDRE
EIENNSYHMHPAGIILTKVGYYTIPSMDDLAKITNEKGECIVSDFTIGRKGYGSIYFEGD
VNLTNLNLDDIVHIRRKEVVVYLDDNQKPPVGEGLNRKAEVTLDGVWPTDKTSRCLIKSP
DRLADINYEGRLEAVSRKQGAQFKEYRPETGSWVFKVSHFSKYGLQDSDEEEEEHPSKTS
TKKLKTAPLPPASQTTPLQMALNGKPAPPPQSQSPEVEQLGRVVELDSDMVDITQEPVLD
TMLEESMPEDQEPVSASTHIASSLGINPHVLQIMKASLLTDEEDVDMALDQRFSRLPSKA
DTSQEICSPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIP
STSSWSVPPPLTSVFTMPSPAPEVPLKTVGTRRQLGLVPREKSVTYGKGKLLMDMALFMG
RSFRVGWGPNWTLANSGEQLNGSHELENHQIADSMEFGFLPNPVAVKPLTESPFKVHLEK
LSLRQRKPDEDMKLYQTPLELKLKHSTVHVDELCPLIVPNLGVAVIHDYADWVKEASGDL
PEAQIVKHWSLTWTLCEALWGHLKELDSQLNEPREYIQILERRRAFSRWLSCTATPQIEE
EVSLTQKNSPVEAVFSYLTGKRISEACSLAQQSGDHRLALLLSQFVGSQSVRELLTMQLV
DWHQLQADSFIQDERLRIFALLAGKPVWQLSEKKQINVCSQLDWKRSLAIHLWYLLPPTA
SISRALSMYEEAFQNTSDSDRYACSPLPSYLEGSGCVIAEEQNSQTPLRDVCFHLLKLYS
DRHYDLNQLLEPRSITADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEG
LWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAK
AVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERS
SLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKD
RLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDE
LRSLTQSYLRELAVGSL