ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4916

Name

NTRK3

Synonym

GP145-TrkC|TRKC|gp145(trkC);neurotrophic tyrosine kinase, receptor, type 3;NTRK3;neurotrophic tyrosine kinase, receptor, type 3

Definition

ETS related protein-neurotrophic receptor tyrosine kinase fusion protein|ETV6-NTRK3 fusion|NT-3 growth factor receptor|tyrosine kinase receptor C

Position

15q25

Gene Type

protein-coding

Pathways and Diseases

Pathway

Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Disease

Cancers of the nervous system;KEGG DISEASE

Disease

Neuroblastoma;KEGG DISEASE;H00043

Disease

Cancers;KEGG DISEASE

Disease

PSYCH;GAD

Disease

panic disorder;GAD

External Links

Links to cell senescence gene database

4916

Links to epithelial mesenchymal transition gene database

4916

Links to ovarian cancer gene database

4916

Links to endometrial cancer gene database

4916

Links to iHOP

4916

Sequence Information

Nucleotide Sequence

>4916 : length: 4942
GGAGGGAGGGAGCCGAGGAAGACGCTCCGATAACCCGTGCGTTTCGTAAGGCTCGGAGCA
CTTGTACATTTCTGCAGCCGCGCGGCGAGCCATTCGCGGCGGCTGCTGCAGCTCCTACTG
CATCTTCCTTCTCTTCCTTTCCTCGGGCTCCGGGTGTGTGTATGTGTGAGAGTGAGTGTG
TGTGTTTTGCAGGTGCGTGGTGTGTCCGTTTTAATTCTGCCCAGTAGGTGGGACTTGGTG
ACTTTAGCACCATTTTTTCCTTTTCCTTTTTTTTTTTTGCCTCCCCACCGTCTGTTGCAA
CCCTGCAAAGTCTCGGAGTCGGAGAGCGCGCCTCGCTTCCAGAGCCCCCGGACCCGGCGA
GTCAGCGATCGCCGAGCCGGCCACCATGCCCGGCAGACCGCGCCACTAGGCGCTCCTCGC
GGCTCCCACCCGGCGGCGGCGGCGGCGGCGGCGGCGTCCGCGATGGTTTCAGACGCTGAA
GGATTTTGCATCTGATCGCTCGGCGTTTCAAAGAAGCAGCGATCGGAGATGGATGTCTCT
CTTTGCCCAGCCAAGTGTAGTTTCTGGCGGATTTTCTTGCTGGGAAGCGTCTGGCTGGAC
TATGTGGGCTCCGTGCTGGCTTGCCCTGCAAATTGTGTCTGCAGCAAGACTGAGATCAAT
TGCCGGCGGCCGGACGATGGGAACCTCTTCCCCCTCCTGGAAGGGCAGGATTCAGGGAAC
AGCAATGGGAACGCCAGTATCAACATCACGGACATCTCAAGGAATATCACTTCCATACAC
ATAGAGAACTGGCGCAGTCTTCACACGCTCAACGCCGTGGACATGGAGCTCTACACCGGA
CTTCAAAAGCTGACCATCAAGAACTCAGGACTTCGGAGCATTCAGCCCAGAGCCTTTGCC
AAGAACCCCCATTTGCGTTATATAAACCTGTCAAGTAACCGGCTCACCACACTCTCGTGG
CAGCTCTTCCAGACGCTGAGTCTTCGGGAATTGCAGTTGGAGCAGAACTTTTTCAACTGC
AGCTGTGACATCCGCTGGATGCAGCTCTGGCAGGAGCAGGGGGAGGCCAAGCTCAACAGC
CAGAACCTCTACTGCATCAACGCTGATGGCTCCCAGCTTCCTCTCTTCCGCATGAACATC
AGTCAGTGTGACCTTCCTGAGATCAGCGTGAGCCACGTCAACCTGACCGTACGAGAGGGT
GACAACGCTGTTATCACTTGCAATGGCTCTGGATCACCCCTTCCTGATGTGGACTGGATA
GTCACTGGGCTGCAGTCCATCAACACTCACCAGACCAATCTGAACTGGACCAATGTTCAT
GCCATCAACTTGACGCTGGTGAATGTGACGAGTGAGGACAATGGCTTCACCCTGACGTGC
ATTGCAGAGAACGTGGTGGGCATGAGCAATGCCAGTGTTGCCCTCACTGTCTACTATCCC
CCACGTGTGGTGAGCCTGGAGGAGCCTGAGCTGCGCCTGGAGCACTGCATCGAGTTTGTG
GTGCGTGGCAACCCCCCACCAACGCTGCACTGGCTGCACAATGGGCAGCCTCTGCGGGAG
TCCAAGATCATCCATGTGGAATACTACCAAGAGGGAGAGATTTCCGAGGGCTGCCTGCTC
TTCAACAAGCCCACCCACTACAACAATGGCAACTATACCCTCATTGCCAAAAACCCACTG
GGCACAGCCAACCAGACCATCAATGGCCACTTCCTCAAGGAGCCCTTTCCAGAGAGCACG
GATAACTTTATCTTGTTTGACGAAGTGAGTCCCACACCTCCTATCACTGTGACCCACAAA
CCAGAAGAAGACACTTTTGGGGTATCCATAGCAGTTGGACTTGCTGCTTTTGCCTGTGTC
CTGTTGGTGGTTCTCTTCGTCATGATCAACAAATATGGTCGACGGTCCAAATTTGGAATG
AAGGGTCCCGTGGCTGTCATCAGTGGTGAGGAGGACTCAGCCAGCCCACTGCACCACATC
AACCACGGCATCACCACGCCCTCGTCACTGGATGCCGGGCCCGACACTGTGGTCATTGGC
ATGACTCGCATCCCTGTCATTGAGAACCCCCAGTACTTCCGTCAGGGACACAACTGCCAC
AAGCCGGACACGTATGTGCAGCACATTAAGAGGAGAGACATCGTGCTGAAGCGAGAACTG
GGTGAGGGAGCCTTTGGAAAGGTCTTCCTGGCCGAGTGCTACAACCTCAGCCCGACCAAG
GACAAGATGCTTGTGGCTGTGAAGGCCCTGAAGGATCCCACCCTGGCTGCCCGGAAGGAT
TTCCAGAGGGAGGCCGAGCTGCTCACCAACCTGCAGCATGAGCACATTGTCAAGTTCTAT
GGAGTGTGCGGCGATGGGGACCCCCTCATCATGGTCTTTGAATACATGAAGCATGGAGAC
CTGAATAAGTTCCTCAGGGCCCATGGGCCAGATGCAATGATCCTTGTGGATGGACAGCCA
CGCCAGGCCAAGGGTGAGCTGGGGCTCTCCCAAATGCTCCACATTGCCAGTCAGATCGCC
TCGGGTATGGTGTACCTGGCCTCCCAGCACTTTGTGCACCGAGACCTGGCCACCAGGAAC
TGCCTGGTTGGAGCGAATCTGCTAGTGAAGATTGGGGACTTCGGCATGTCCAGAGATGTC
TACAGCACGGATTATTACAGGGTGGGAGGACACACCATGCTCCCCATTCGCTGGATGCCT
CCTGAAAGCATCATGTACCGGAAGTTCACTACAGAGAGTGATGTATGGAGCTTCGGGGTG
ATCCTCTGGGAGATCTTCACCTATGGAAAGCAGCCATGGTTCCAACTCTCAAACACGGAG
GTCATTGAGTGCATTACCCAAGGTCGTGTTTTGGAGCGGCCCCGAGTCTGCCCCAAAGAG
GTGTACGATGTCATGCTGGGGTGCTGGCAGAGGGAACCACAGCAGCGGTTGAACATCAAG
GAGATCTACAAAATCCTCCATGCTTTGGGGAAGGCCACCCCAATCTACCTGGACATTCTT
GGCTAGTGGTGGCTGGTGGTCATGAATTCATACTCTGTTGCCTCCTCTCTCCCTGCCTCA
CATCTCCCTTCCACCTCACAACTCCTTCCATCCTTGACTGAAGCGAACATCTTCATATAA
ACTCAAGTGCCTGCTACACATACAACACTGAAAAAAGGAAAAAAAAAGAAAGAAAAAAAA
ACCCTGTAAGGCAGTTTGGCAAATATATATATATATATATATATTTATATATCTAACTAT
CTATCAATCTATATCTACAGAGAGTTACCTTCTCTAGTACACAGAGAAGCTGCTGATACA
GAAAACCACAAGACTTTAACAACTCAGAAACTCTAAAATATTAATAATACAAAGGAAAAT
TCCCTTTGACTTAAGCTGTGGCCCATGCTTCTAATGCTACGGCTCTTTGGAGCAGAAGAC
CTGGACCATGCAGAGAGACAATCTTTGGGATGAGAGCTCTGGGACGGGAGGAGTTAAGGT
GGTGCTCAGTCGCTGCTGTGTGTGTCTGTTACCCCGGAAGCTCACCACAGGCACATGTGG
GGACTGCATGGCTGTGCTCAGCAAAGAAATGATGCCTGAGCAGGGTCCTTGCCTCCACTT
CTTCCCCATTTCCTCCACTTCAGGACAATGTTCTAATTTGTCCATTCTAAAAAGTGTAAT
CTTGATGCTTTTGGGAATCAATGATGGCACCTACGGGTAAACACAGAACAGACAACCCCA
CAACACAAAACCATGACAAGAGCTGACAGCATCCATCCTGGGTGTAAGCTTCTTGCTGGA
GTTGCAAAGGATGTGTCTTTCTATTCTCAGAACTTAAAGAACTGGACTTTCTGGAGTAAA
AGAACCACAGAAGAAAAAATAGCTGAAACCTGAACCCTGCCAAGACACTGCCACCTGTCT
TTTCCATCATTGCAAAGATTCCTTGGCCTCACCTCCCACTTTCAGGCCCCTGGGAAGCTT
AGGGGGTTAGGAAACAGGTCCCCATGTTATCTTTGAATGTAGACACAGCACGCTTTAGGG
TTGCAATAGCAAGAGACTTGGTTGCTTGTAGGTCATTATAACGAATGCCCCCTGGTCCTC
TCAGTTTCTCATCCTGCTTCCCTAGATCCTAGACCCCACTTCCTGGGTCTCTACTGAGTC
CCAGGTAAACCCCACTGCCAAGGAAGGGAGCCAGGTCTAGTGAGAGGCTGCAGCAGTGAG
TGTTTCAGGAAAGCAAGCAGTGGAGTGGGTGAGAGCCAGCAGGGGAGAATCTACTTGGCA
CCTGTGCCAGGCCCCTTGGCATTCTCCTCACGTTTCCAGCCCCTGGGAGGATTGATGCAT
CTGCCTTTGAGCTGTTGTGAAAACGCAGGGGCTGAGAAATCACTTTTGTGGGCTGGGGTA
GGGGGAAGGGCTGAGGCTTCTCTGGGAGATGTCCAATGAGCGGCCAGTGCTGCAGGCTTG
GAATCTTAATGAGGCCTGAGCCCTGACCGGAGAGAGGGAAGGAAACATCTGTGCTGGGGC
CTGCTCCCTCTGCCCCAGCACTGGGGAATCACTGCCTTCCTGGCTGCTGCCACATACCAC
AGTGGGGCCGACCTCTGGGCCTCCCTGTCACATGAAACATGGAAGCCAACAGCCTGGCCC
CACAGATCTCCTCTGCTGGAGAGGAGAGGATGTGTTCCTCCCAGGCCACGGGGCCCCTCT
GCCTTGCCCCAAGCACAGAGCTACCTAAGGGACTGACCTTTGCCACACTGGAGCTCACCT
CCCGGGGGCCTCTGGCCTACCCTTTTCCCTGCCAGCTGAAGAGACTGCCGGCAGCCTGGA
CGTCCTGGTTAGCTGAAGGCAGCTGAAATGTGGGCCTCCCTATGTGGGGTTTAGTACTGA
ATTATGTGTTTGTGGTTTTGCTTCTTTTTGTAGACCCACAAATATTTTTATTTGAATAGT
AAAGAGCTGTGCTCAGATTGTA

Protein Sequence

>4916 : length: 850
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEA
KLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISE
GCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVL
KRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHI
VKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIA
SQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYREGPCQKGPF
SVVWQRQRLAATAASTVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQ
PWFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGK
ATPIYLDILG