ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4914

Name

NTRK1

Synonym

MTC|TRK|TRK1|TRKA|Trk-A|p140-TrkA;neurotrophic tyrosine kinase, receptor, type 1;NTRK1;neurotrophic tyrosine kinase, receptor, type 1

Definition

Oncogene TRK|TRK1-transforming tyrosine kinase protein|gp140trk|high affinity nerve growth factor receptor|tropomyosin-related kinase A|tyrosine kinase receptor A

Position

1q21-q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

ARMS-mediated activation;PID Reactome;500631

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Trk receptor signaling mediated by PI3K and PLC-gamma;PID Curated;200183

Pathway

Retrograde neurotrophin signalling;PID Reactome;500645

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

Signalling to RAS;PID Reactome;500626

Pathway

Signalling to STAT3;PID Reactome;500643

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

PLC-gamma1 signalling;PID Reactome;500632

Pathway

Neurotrophic factor-mediated Trk receptor signaling;PID Curated;200128

Pathway

Signalling to ERKs;PID Reactome;500625

Pathway

NGF signalling via TRKA from the plasma membrane;PID Reactome;500621

Pathway

PI3K/AKT signalling;PID Reactome;500639

Pathway

TRKA activation by NGF;PID Reactome;500623

Pathway

role of erk5 in neuronal survival pathway;PID BioCarta;100171

Pathway

trka receptor signaling pathway;PID BioCarta;100011

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Signalling to p38 via RIT and RIN;PID Reactome;500628

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Disease

Cancers of the nervous system;KEGG DISEASE

Disease

Thyroid cancer;KEGG DISEASE;H00032

Disease

Cancers;KEGG DISEASE

Disease

Insensitivity to pain, congenital, with anhidrosis;OMIM

Disease

Medullary thyroid carcinoma, familial;OMIM

Disease

Neuroblastoma;KEGG DISEASE;H00043

Disease

Cancers of endocrine organs;KEGG DISEASE

Disease

CANCER;GAD

Disease

neuroblastoma;GAD

External Links

Links to cell senescence gene database

4914

Links to epithelial mesenchymal transition gene database

4914

Links to ovarian cancer gene database

4914

Links to endometrial cancer gene database

4914

Links to iHOP

4914

Sequence Information

Nucleotide Sequence

>4914 : length: 2663
TGCAGCTGGGAGCGCACAGACGGCTGCCCCGCCTGAGCGAGGCGGGCGCCGCCGCGATGC
TGCGAGGCGGACGGCGCGGGCAGCTTGGCTGGCACAGCTGGGCTGCGGGGCCGGGCAGCC
TGCTGGCTTGGCTGATACTGGCATCTGCGGGCGCCGCACCCTGCCCCGATGCCTGCTGCC
CCCACGGCTCCTCGGGACTGCGATGCACCCGGGATGGGGCCCTGGATAGCCTCCACCACC
TGCCCGGCGCAGAGAACCTGACTGAGCTCTACATCGAGAACCAGCAGCATCTGCAGCATC
TGGAGCTCCGTGATCTGAGGGGCCTGGGGGAGCTGAGAAACCTCACCATCGTGAAGAGTG
GTCTCCGTTTCGTGGCGCCAGATGCCTTCCATTTCACTCCTCGGCTCAGTCGCCTGAATC
TCTCCTTCAACGCTCTGGAGTCTCTCTCCTGGAAAACTGTGCAGGGCCTCTCCTTACAGG
AACTGGTCCTGTCGGGGAACCCTCTGCACTGTTCTTGTGCCCTGCGCTGGCTACAGCGCT
GGGAGGAGGAGGGACTGGGCGGAGTGCCTGAACAGAAGCTGCAGTGTCATGGGCAAGGGC
CCCTGGCCCACATGCCCAATGCCAGCTGTGGTGTGCCCACGCTGAAGGTCCAGGTGCCCA
ATGCCTCGGTGGATGTGGGGGACGACGTGCTGCTGCGGTGCCAGGTGGAGGGGCGGGGCC
TGGAGCAGGCCGGCTGGATCCTCACAGAGCTGGAGCAGTCAGCCACGGTGATGAAATCTG
GGGGTCTGCCATCCCTGGGGCTGACCCTGGCCAATGTCACCAGTGACCTCAACAGGAAGA
ACGTGACGTGCTGGGCAGAGAACGATGTGGGCCGGGCAGAGGTCTCTGTTCAGGTCAACG
TCTCCTTCCCGGCCAGTGTGCAGCTGCACACGGCGGTGGAGATGCACCACTGGTGCATCC
CCTTCTCTGTGGATGGGCAGCCGGCACCGTCTCTGCGCTGGCTCTTCAATGGCTCCGTGC
TCAATGAGACCAGCTTCATCTTCACTGAGTTCCTGGAGCCGGCAGCCAATGAGACCGTGC
GGCACGGGTGTCTGCGCCTCAACCAGCCCACCCACGTCAACAACGGCAACTACACGCTGC
TGGCTGCCAACCCCTTCGGCCAGGCCTCCGCCTCCATCATGGCTGCCTTCATGGACAACC
CTTTCGAGTTCAACCCCGAGGACCCCATCCCTGTCTCCTTCTCGCCGGTGGACACTAACA
GCACATCTGGAGACCCGGTGGAGAAGAAGGACGAAACACCTTTTGGGGTCTCGGTGGCTG
TGGGCCTGGCCGTCTTTGCCTGCCTCTTCCTTTCTACGCTGCTCCTTGTGCTCAACAAAT
GTGGACGGAGAAACAAGTTTGGGATCAACCGCCCGGCTGTGCTGGCTCCAGAGGATGGGC
TGGCCATGTCCCTGCATTTCATGACATTGGGTGGCAGCTCCCTGTCCCCCACCGAGGGCA
AAGGCTCTGGGCTCCAAGGCCACATCATCGAGAACCCACAATACTTCAGTGATGCCTGTG
TTCACCACATCAAGCGCCGGGACATCGTGCTCAAGTGGGAGCTGGGGGAGGGCGCCTTTG
GGAAGGTCTTCCTTGCTGAGTGCCACAACCTCCTGCCTGAGCAGGACAAGATGCTGGTGG
CTGTCAAGGCACTGAAGGAGGCGTCCGAGAGTGCTCGGCAGGACTTCCAGCGTGAGGCTG
AGCTGCTCACCATGCTGCAGCACCAGCACATCGTGCGCTTCTTCGGCGTCTGCACCGAGG
GCCGCCCCCTGCTCATGGTCTTTGAGTATATGCGGCACGGGGACCTCAACCGCTTCCTCC
GATCCCATGGACCTGATGCCAAGCTGCTGGCTGGTGGGGAGGATGTGGCTCCAGGCCCCC
TGGGTCTGGGGCAGCTGCTGGCCGTGGCTAGCCAGGTCGCTGCGGGGATGGTGTACCTGG
CGGGTCTGCATTTTGTGCACCGGGACCTGGCCACACGCAACTGTCTAGTGGGCCAGGGAC
TGGTGGTCAAGATTGGTGATTTTGGCATGAGCAGGGATATCTACAGCACCGACTATTACC
GTGTGGGAGGCCGCACCATGCTGCCCATTCGCTGGATGCCGCCCGAGAGCATCCTGTACC
GTAAGTTCACCACCGAGAGCGACGTGTGGAGCTTCGGCGTGGTGCTCTGGGAGATCTTCA
CCTACGGCAAGCAGCCCTGGTACCAGCTCTCCAACACGGAGGCAATCGACTGCATCACGC
AGGGACGTGAGTTGGAGCGGCCACGTGCCTGCCCACCAGAGGTCTACGCCATCATGCGGG
GCTGCTGGCAGCGGGAGCCCCAGCAACGCCACAGCATCAAGGATGTGCACGCCCGGCTGC
AAGCCCTGGCCCAGGCACCTCCTGTCTACCTGGATGTCCTGGGCTAGGGGGCCGGCCCAG
GGGCTGGGAGTGGTTAGCCGGAATACTGGGGCCTGCCCTCAGCATCCCCCATAGCTCCCA
GCAGCCCCAGGGTGATCTCAAAGTATCTAATTCACCCTCAGCATGTGGGAAGGGACAGGT
GGGGGCTGGGAGTAGAGGATGTTCCTGCTTCTCTAGGCAAGGTCCCGTCATAGCAATTAT
ATTTATTATCCCTTGAAAAAAAA

Protein Sequence

>4914 : length: 796
MLRGGRRGQLGWHSWAAGPGSLLAWLILASAGAAPCPDACCPHGSSGLRCTRDGALDSLH
HLPGAENLTELYIENQQHLQHLELRDLRGLGELRNLTIVKSGLRFVAPDAFHFTPRLSRL
NLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQ
GPLAHMPNASCGVPTLKVQVPNASVDVGDDVLLRCQVEGRGLEQAGWILTELEQSATVMK
SGGLPSLGLTLANVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHTAVEMHHWC
IPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYT
LLAANPFGQASASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSV
AVGLAVFACLFLSTLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTE
GKGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKML
VAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRF
LRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQ
GLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEI
FTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHAR
LQALAQAPPVYLDVLG