ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4904

Name

YBX1

Synonym

BP-8|CSDA2|CSDB|DBPB|MDR-NF1|NSEP-1|NSEP1|YB-1|YB1;Y box binding protein 1;YBX1;Y box binding protein 1

Definition

CBF-A|CCAAT-binding transcription factor I subunit A|DNA-binding protein B|EFI-A|Y-box transcription factor|Y-box-binding protein 1|enhancer factor I subunit A|major histocompatibility complex, class II, Y box-binding protein I|nuclease sensitive element

Position

1p34

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

mRNA Processing;Reactome;REACT:1675

Pathway

transcriptional activation of dbpb from mrna;PID BioCarta;100190

Pathway

Gene Expression;Reactome;REACT:71

Pathway

mRNA Splicing - Major Pathway;PID Reactome;500866

External Links

Links to cell senescence gene database

4904

Links to epithelial mesenchymal transition gene database

4904

Links to ovarian cancer gene database

4904

Links to endometrial cancer gene database

4904

Links to iHOP

4904

Sequence Information

Nucleotide Sequence

>4904 : length: 1561
GGGCTTATCCCGCCTGTCCCGCCATTCTCGCTAGTTCGATCGGTAGCGGGAGCGGAGAGC
GGACCCCAGAGAGCCCTGAGCAGCCCCACCGCCGCCGCCGGCCTAGTTACCATCACACCC
CGGGAGGAGCCGCAGCTGCCGCAGCCGGCCCCAGTCACCATCACCGCAACCATGAGCAGC
GAGGCCGAGACCCAGCAGCCGCCCGCCGCCCCCCCCGCCGCCCCCGCCCTCAGCGCCGCC
GACACCAAGCCCGGCACTACGGGCAGCGGCGCAGGGAGCGGTGGCCCGGGCGGCCTCACA
TCGGCGGCGCCTGCCGGCGGGGACAAGAAGGTCATCGCAACGAAGGTTTTGGGAACAGTA
AAATGGTTCAATGTAAGGAACGGATATGGTTTCATCAACAGGAATGACACCAAGGAAGAT
GTATTTGTACACCAGACTGCCATAAAGAAGAATAACCCCAGGAAGTACCTTCGCAGTGTA
GGAGATGGAGAGACTGTGGAGTTTGATGTTGTTGAAGGAGAAAAGGGTGCGGAGGCAGCA
AATGTTACAGGTCCTGGTGGTGTTCCAGTTCAAGGCAGTAAATATGCAGCAGACCGTAAC
CATTATAGACGCTATCCACGTCGTAGGGGTCCTCCACGCAATTACCAGCAAAATTACCAG
AATAGTGAGAGTGGGGAAAAGAACGAGGGATCGGAGAGTGCTCCCGAAGGCCAGGCCCAA
CAACGCCGGCCCTACCGCAGGCGAAGGTTCCCACCTTACTACATGCGGAGACCCTATGGG
CGTCGACCACAGTATTCCAACCCTCCTGTGCAGGGAGAAGTGATGGAGGGTGCTGACAAC
CAGGGTGCAGGAGAACAAGGTAGACCAGTGAGGCAGAATATGTATCGGGGATATAGACCA
CGATTCCGCAGGGGCCCTCCTCGCCAAAGACAGCCTAGAGAGGACGGCAATGAAGAAGAT
AAAGAAAATCAAGGAGATGAGACCCAAGGTCAGCAGCCACCTCAACGTCGGTACCGCCGC
AACTTCAATTACCGACGCAGACGCCCAGAAAACCCTAAACCACAAGATGGCAAAGAGACA
AAAGCAGCCGATCCACCAGCTGAGAATTCGTCCGCTCCCGAGGCTGAGCAGGGCGGGGCT
GAGTAAATGCCGGCTTACCATCTCTACCATCATCCGGTTTAGTCATCCAACAAGAAGAAA
TATGAAATTCCAGCAATAAGAAATGAACAAAAGATTGGAGCTGAAGACCTAAAGTGCTTG
CTTTTTGCCCGTTGACCAGATAAATAGAACTATCTGCATTATCTATGCAGCATGGGGTTT
TTATTATTTTTACCTAAAGACGTCTCTTTTTGGTAATAACAAACGTGTTTTTTAAAAAAG
CCTGGTTTTTCTCAATACGCCTTTAAAGGTTTTTAAATTGTTTCATATCTGGTCAAGTTG
AGATTTTTAAGAACTTCATTTTTAATTTGTAATAAAAGTTTACAACTTGATTTTTTCAAA
AAAGTCAACAAACTGCAAGCACCTGTTAATAAAGGTCTTAAATAATAAAAAAAAAAAAAA
A

Protein Sequence

>4904 : length: 324
MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVL
GTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGA
EAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEG
QAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRG
YRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDG
KETKAADPPAENSSAPEAEQGGAE