ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4893

Name

NRAS

Synonym

ALPS4|CMNS|N-ras|NCMS|NRAS1|NS6;neuroblastoma RAS viral (v-ras) oncogene homolog;NRAS;neuroblastoma RAS viral (v-ras) oncogene homolog

Definition

GTPase NRas|N-ras protein part 4|transforming protein N-Ras|v-ras neuroblastoma RAS viral oncogene homolog

Position

1p13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

Signaling by Insulin receptor;Reactome;REACT:498

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Signaling by EGFR;Reactome;REACT:9417

Pathway

T cell activation;PANTHER;P00053

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

PI3 kinase pathway;PANTHER;P00048

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Insulin signaling pathway;KEGG PATHWAY;hsa04910

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Signaling by PDGF;Reactome;REACT:16888

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

B cell activation;PANTHER;P00010

Pathway

Long-term potentiation;KEGG PATHWAY;hsa04720

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Gap junction;KEGG PATHWAY;hsa04540

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Long-term depression;KEGG PATHWAY;hsa04730

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Thyroid cancer;KEGG DISEASE;H00032

Disease

leukemia, myeloid;GAD

Disease

Adrenal carcinoma;KEGG DISEASE;H00033

Disease

Colorectal cancer;OMIM

Disease

Autoimmune lymphoproliferative syndrome type IV;OMIM

Disease

Multiple myeloma;KEGG DISEASE;H00010

Disease

Skin cancers;KEGG DISEASE

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Cancers of endocrine organs;KEGG DISEASE

Disease

Thyroid carcinoma, follicular;OMIM

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

Autoimmune lymphoproliferative syndromes;KEGG DISEASE;H00108

Disease

Hepatocellular carcinoma;KEGG DISEASE;H00048

Disease

CANCER;GAD

Disease

Oral cancer;KEGG DISEASE;H00016

Disease

melanoma;GAD

Disease

Noonan syndrome 6;OMIM

Disease

Primary immunodeficiency;KEGG DISEASE

Disease

Cancers;KEGG DISEASE

Disease

Acute myeloid leukemia (AML);KEGG DISEASE;H00003

Disease

Malignant melanoma;KEGG DISEASE;H00038

Disease

Immune system diseases;KEGG DISEASE

Disease

clonal homozygosity of rectal cell carcinoma;GAD

Disease

Head and neck cancers;KEGG DISEASE

External Links

Links to cell senescence gene database

4893

Links to epithelial mesenchymal transition gene database

4893

Links to ovarian cancer gene database

4893

Links to endometrial cancer gene database

4893

Links to iHOP

4893

Sequence Information

Nucleotide Sequence

>4893 : length: 4454
GAAACGTCCCGTGTGGGAGGGGCGGGTCTGGGTGCGGCCTGCCGCATGACTCGTGGTTCG
GAGGCCCACGTGGCCGGGGCGGGGACTCAGGCGCCTGGGGCGCCGACTGATTACGTAGCG
GGCGGGGCCGGAAGTGCCGCTCCTTGGTGGGGGCTGTTCATGGCGGTTCCGGGGTCTCCA
ACATTTTTCCCGGCTGTGGTCCTAAATCTGTCCAAAGCAGAGGCAGTGGAGCTTGAGGTT
CTTGCTGGTGTGAAATGACTGAGTACAAACTGGTGGTGGTTGGAGCAGGTGGTGTTGGGA
AAAGCGCACTGACAATCCAGCTAATCCAGAACCACTTTGTAGATGAATATGATCCCACCA
TAGAGGATTCTTACAGAAAACAAGTGGTTATAGATGGTGAAACCTGTTTGTTGGACATAC
TGGATACAGCTGGACAAGAAGAGTACAGTGCCATGAGAGACCAATACATGAGGACAGGCG
AAGGCTTCCTCTGTGTATTTGCCATCAATAATAGCAAGTCATTTGCGGATATTAACCTCT
ACAGGGAGCAGATTAAGCGAGTAAAAGACTCGGATGATGTACCTATGGTGCTAGTGGGAA
ACAAGTGTGATTTGCCAACAAGGACAGTTGATACAAAACAAGCCCACGAACTGGCCAAGA
GTTACGGGATTCCATTCATTGAAACCTCAGCCAAGACCAGACAGGGTGTTGAAGATGCTT
TTTACACACTGGTAAGAGAAATACGCCAGTACCGAATGAAAAAACTCAACAGCAGTGATG
ATGGGACTCAGGGTTGTATGGGATTGCCATGTGTGGTGATGTAACAAGATACTTTTAAAG
TTTTGTCAGAAAAGAGCCACTTTCAAGCTGCACTGACACCCTGGTCCTGACTTCCCTGGA
GGAGAAGTATTCCTGTTGCTGTCTTCAGTCTCACAGAGAAGCTCCTGCTACTTCCCCAGC
TCTCAGTAGTTTAGTACAATAATCTCTATTTGAGAAGTTCTCAGAATAACTACCTCCTCA
CTTGGCTGTCTGACCAGAGAATGCACCTCTTGTTACTCCCTGTTATTTTTCTGCCCTGGG
TTCTTCCACAGCACAAACACACCTCTGCCACCCCAGGTTTTTCATCTGAAAAGCAGTTCA
TGTCTGAAACAGAGAACCAAACCGCAAACGTGAAATTCTATTGAAAACAGTGTCTTGAGC
TCTAAAGTAGCAACTGCTGGTGATTTTTTTTTTCTTTTTACTGTTGAACTTAGAACTATG
CTAATTTTTGGAGAAATGTCATAAATTACTGTTTTGCCAAGAATATAGTTATTATTGCTG
TTTGGTTTGTTTATAATGTTATCGGCTCTATTCTCTAAACTGGCATCTGCTCTAGATTCA
TAAATACAAAAATGAATACTGAATTTTGAGTCTATCCTAGTCTTCACAACTTTGACGTAA
TTAAATCCAACTTTCACAGTGAAGTGCCTTTTTCCTAGAAGTGGTTTGTAGACTTCCTTT
ATAATATTTCAGTGGAATAGATGTCTCAAAAATCCTTATGCATGAAATGAATGTCTGAGA
TACGTCTGTGACTTATCTACCATTGAAGGAAAGCTATATCTATTTGAGAGCAGATGCCAT
TTTGTACATGTATGAAATTGGTTTTCCAGAGGCCTGTTTTGGGGCTTTCCCAGGAGAAAG
ATGAAACTGAAAGCACATGAATAATTTCACTTAATAATTTTTACCTAATCTCCACTTTTT
TCATAGGTTACTACCTATACAATGTATGTAATTTGTTTCCCCTAGCTTACTGATAAACCT
AATATTCAATGAACTTCCATTTGTATTCAAATTTGTGTCATACCAGAAAGCTCTACATTT
GCAGATGTTCAAATATTGTAAAACTTTGGTGCATTGTTATTTAATAGCTGTGATCAGTGA
TTTTCAAACCTCAAATATAGTATATTAACAAATTACATTTTCACTGTATATCATGGTATC
TTAATGATGTATATAATTGCCTTCAATCCCCTTCTCACCCCACCCTCTACAGCTTCCCCC
ACAGCAATAGGGGCTTGATTATTTCAGTTGAGTAAAGCATGGTGCTAATGGACCAGGGTC
ACAGTTTCAAAACTTGAACAATCCAGTTAGCATCACAGAGAAAGAAATTCTTCTGCATTT
GCTCATTGCACCAGTAACTCCAGCTAGTAATTTTGCTAGGTAGCTGCAGTTAGCCCTGCA
AGGAAAGAAGAGGTCAGTTAGCACAAACCCTTTACCATGACTGGAAAACTCAGTATCACG
TATTTAAACATTTTTTTTTCTTTTAGCCATGTAGAAACTCTAAATTAAGCCAATATTCTC
ATTTGAGAATGAGGATGTCTCAGCTGAGAAACGTTTTAAATTCTCTTTATTCATAATGTT
CTTTGAAGGGTTTAAAACAAGATGTTGATAAATCTAAGCTGATGAGTTTGCTCAAAACAG
GAAGTTGAAATTGTTGAGACAGGAATGGAAAATATAATTAATTGATACCTATGAGGATTT
GGAGGCTTGGCATTTTAATTTGCAGATAATACCCTGGTAATTCTCATGAAAAATAGACTT
GGATAACTTTTGATAAAAGACTAATTCCAAAATGGCCACTTTGTTCCTGTCTTTAATATC
TAAATACTTACTGAGGTCCTCCATCTTCTATATTATGAATTTTCATTTATTAAGCAAATG
TCATATTACCTTGAAATTCAGAAGAGAAGAAACATATACTGTGTCCAGAGTATAATGAAC
CTGCAGAGTTGTGCTTCTTACTGCTAATTCTGGGAGCTTTCACAGTACTGTCATCATTTG
TAAATGGAAATTCTGCTTTTCTGTTTCTGCTCCTTCTGGAGCAGTGCTACTCTGTAATTT
TCCTGAGGCTTATCACCTCAGTCATTTCTTTTTTAAATGTCTGTGACTGGCAGTGATTCT
TTTTCTTAAAAATCTATTAAATTTGATGTCAAATTAGGGAGAAAGATAGTTACTCATCTT
GGGCTCTTGTGCCAATAGCCCTTGTATGTATGTACTTAGAGTTTTCCAAGTATGTTCTAA
GCACAGAAGTTTCTAAATGGGGCCAAAATTCAGACTTGAGTATGTTCTTTGAATACCTTA
AGAAGTTACAATTAGCCGGGCATGGTGGCCCGTGCCTGTAGTCCCAGCTACTTGAGAGGC
TGAGGCAGGAGAATCACTTCAACCCAGGAGGTGGAGGTTACAGTGAGCAGAGATCGTGCC
ACTGCACTCCAGCCTGGGTGACAAGAGAGACTTGTCTCCAAAAAAAAAGTTACACCTAGG
TGTGAATTTTGGCACAAAGGAGTGACAAACTTATAGTTAAAAGCTGAATAACTTCAGTGT
GGTATAAAACGTGGTTTTTAGGCTATGTTTGTGATTGCTGAAAAGAATTCTAGTTTACCT
CAAAATCCTTCTCTTTCCCCAAATTAAGTGCCTGGCCAGCTGTCATAAATTACATATTCC
TTTTGGTTTTTTTAAAGGTTACATGTTCAAGAGTGAAAATAAGATGTTCTGTCTGAAGGC
TACCATGCCGGATCTGTAAATGAACCTGTTAAATGCTGTATTTGCTCCAACGGCTTACTA
TAGAATGTTACTTAATACAATATCATACTTATTACAATTTTTACTATAGGAGTGTAATAG
GTAAAATTAATCTCTATTTTAGTGGGCCCATGTTTAGTCTTTCACCATCCTTTAAACTGC
TGTGAATTTTTTTGTCATGACTTGAAAGCAAGGATAGAGAAACACTTTAGAGATATGTGG
GGTTTTTTTACCATTCCAGAGCTTGTGAGCATAATCATATTTGCTTTATATTTATAGTCA
TGAACTCCTAAGTTGGCAGCTACAACCAAGAACCAAAAAATGGTGCGTTCTGCTTCTTGT
AATTCATCTCTGCTAATAAATTATAAGAAGCAAGGAAAATTAGGGAAAATATTTTATTTG
GATGGTTTCTATAAACAAGGGACTATAATTCTTGTACATTATTTTTCATCTTTGCTGTTT
CTTTGAGCAGTCTAATGTGCCACACAATTATCTAAGGTATTTGTTTTCTATAAGAATTGT
TTTAAAAGTATTCTTGTTACCAGAGTAGTTGTATTATATTTCAAAACGTAAGATGATTTT
TAAAAGCCTGAGTACTGACCTAAGATGGAATTGTATGAACTCTGCTCTGGAGGGAGGGGA
GGATGTCCGTGGAAGTTGTAAGACTTTTATTTTTTTGTGCCATCAAATATAGGTAAAAAT
AATTGTGCAATTCTGCTGTTTAAACAGGAACTATTGGCCTCCTTGGCCCTAAATGGAAGG
GCCGATATTTTAAGTTGATTATTTTATTGTAAATTAATCCAACCTAGTTCTTTTTAATTT
GGTTGAATGTTTTTTCTTGTTAAATGATGTTTAAAAAATAAAAACTGGAAGTTCTTGGCT
TAGTCATAATTCTT

Protein Sequence

>4893 : length: 189
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM