ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4869

Name

NPM1

Synonym

B23|NPM;nucleophosmin (nucleolar phosphoprotein B23, numatrin);NPM1;nucleophosmin (nucleolar phosphoprotein B23, numatrin)

Definition

nucleolar protein NO38|nucleophosmin|nucleophosmin/nucleoplasmin family, member 1

Position

5q35.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

BARD1 signaling events;PID Curated;200174

Pathway

Deposition of New CENPA-containing Nucleosomes at the Centromere;PID Reactome;500664

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

Chromosome Maintenance;Reactome;REACT:22172

Pathway

Aurora B signaling;PID Curated;200010

Pathway

HIV Infection;Reactome;REACT:6185

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Disease

CANCER;GAD

Disease

leukemia, myeloid;GAD

Disease

Leukemia, acute myeloid;OMIM

Disease

Leukemia, acute promyelocytic, NPM/RARA type;OMIM

External Links

Links to cell senescence gene database

4869

Links to epithelial mesenchymal transition gene database

4869

Links to ovarian cancer gene database

4869

Links to endometrial cancer gene database

4869

Links to iHOP

4869

Sequence Information

Nucleotide Sequence

>4869 : length: 1761
AGTGCGCGTGCTCGGTGGGAGCCCGCGGAGTACCTGGAAGGAGGTGGGGGCGAGGTAGAA
AGGAGTGGGGTTGAAAAGCGCTTGCGCAGGACGGCTACGGTACGGGGGTGGGAGGGCTTC
GGAGCACGCGCGCGGAGGCGGGACTTGGGAAGCGCTCGCGAGATCTTCAGGGTCTATATA
TAAGCGCGGGGAGCCTGCGTCCTTTCCCTGGTGTGATTCCGTCCTGCGCGGTTGTTCTCT
GGAGCAGCGTTCTTTTATCTCCGTCCGCCTTCTCTCCTACCTAAGTGCGTGCCGCCACCC
GATGGAAGATTCGATGGACATGGACATGAGCCCCCTGAGGCCCCAGAACTATCTTTTCGG
TTGTGAACTAAAGGCCGACAAAGATTATCACTTTAAGGTGGATAATGATGAAAATGAGCA
CCAGTTATCTTTAAGAACGGTCAGTTTAGGGGCTGGTGCAAAGGATGAGTTGCACATTGT
TGAAGCAGAGGCAATGAATTACGAAGGCAGTCCAATTAAAGTAACACTGGCAACTTTGAA
AATGTCTGTACAGCCAACGGTTTCCCTTGGGGGCTTTGAAATAACACCACCAGTGGTCTT
AAGGTTGAAGTGTGGTTCAGGGCCAGTGCATATTAGTGGACAGCACTTAGTAGCTGTGGA
GGAAGATGCAGAGTCAGAAGATGAAGAGGAGGAGGATGTGAAACTCTTAAGTATATCTGG
AAAGCGGTCTGCCCCTGGAGGTGGTAGCAAGGTTCCACAGAAAAAAGTAAAACTTGCTGC
TGATGAAGATGATGACGATGATGATGAAGAGGATGATGATGAAGATGATGATGATGATGA
TTTTGATGATGAGGAAGCTGAAGAAAAAGCGCCAGTGAAGAAAGGACAAGAATCCTTCAA
GAAACAGGAAAAAACTCCTAAAACACCAAAAGGACCTAGTTCTGTAGAAGACATTAAAGC
AAAAATGCAAGCAAGTATAGAAAAAGCGCATTGAACAGTCCTGGGCACTACATGTAAATT
AAGCCCAAAGATGGGGAGAAAGGAAAAGGAGAGACAAATATAGTCCATACTGAGTGTCAT
CAACAATCCAGACTGAAGTCTTCTATTTTAATCTCAATCCCCTTTTCTGATTTGCCACCC
ATGCCTCTTCAGGCTGGAAACAATCTCTTGGTTCCCTAAAGCACTTTCTTCTGACTGCTG
TGATTCAGTGAACCTTGCCCTTTGCTTTCTATTACTTGTGCATTTGCCTCACCTGACAAT
GTTTTAAATCGCCTTTGTATCTCCTTAGCTGCTCAATAAATATTTGAATGCATCAATTAA
GAATGTATGTGACAATAATTTTGAAATGGAAATTGTGAGGTTTATTTTACTAGGTTATTG
GAGGCAGTTAAGTTTCTTAATGCTATACCTGATTCTGCCAAAGTCCCTTGGACATTTGAA
AACCTTTTCAATCTTTTAAAAATGCATAAAAGATACTTAGAGGGAAAGGTATTAATTAAA
TTTAGTAAAAACAAATATATTCAATGCTTTAAATTCCAAAGTAGTGATAAATACAAACAT
TTCAAGATATTTGCAATAGTAATGTTTTGAAATTTTGGTTACAAAGTCACAGGTCTTGCC
AATACTGTTGTAGTTTCTTGCCTATATCCGTAATTTGAAGGAAATGGTGAGAGTGATTAG
AGAAGTGTAATTACTGTAATTTTTTCCCCTATTGTAGTTTCTTGCCTGTATCCATAATTT
GAAGGAAATGGTAAGAGTGAT

Protein Sequence

>4869 : length: 294
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDD
FDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKG
PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL