ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4856

Name

NOV

Synonym

CCN3|IBP-9|IGFBP-9|IGFBP9|NOVh;nephroblastoma overexpressed;NOV;nephroblastoma overexpressed

Definition

CCN family member 3|IGF-binding protein 9|insulin-like growth factor-binding protein 9|nephroblastoma-overexpressed gene protein homolog|protein NOV homolog

Position

8q24.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

4856

Links to epithelial mesenchymal transition gene database

4856

Links to ovarian cancer gene database

4856

Links to endometrial cancer gene database

4856

Links to iHOP

4856

Sequence Information

Nucleotide Sequence

>4856 : length: 2601
AATTGCCATGGCAACCCCGGGGTTCGTTCCACTTCCCCACCCAGCCGATCTCCCCCCTCC
TCCCTGCACTGCAGCCAACCGGCTTGTGCGCGTCCCAGGAGCGCGCTATAAAACCTGTGC
TGGGCGTGATCGGCAAGCACCGGACCAGGGGGAAGGCGAGCAGTGCCAATCTACAGCGAA
GAAAGTCTCGTTTGGTAAAAGCGAGAGGGGAAAGCCTGAGCATGCAGAGTGTGCAGAGCA
CGAGCTTTTGTCTCCGAAAGCAGTGCCTTTGCCTGACCTTCCTGCTTCTCCATCTCCTGG
GACAGGTCGCTGCGACTCAGCGCTGCCCTCCCCAGTGCCCGGGCCGGTGCCCTGCGACGC
CGCCGACCTGCGCCCCCGGGGTGCGCGCGGTGCTGGACGGCTGCTCATGCTGTCTGGTGT
GTGCCCGCCAGCGTGGCGAGAGCTGCTCAGATCTGGAGCCATGCGACGAGAGCAGTGGCC
TCTACTGTGATCGCAGCGCGGACCCCAGCAACCAGACTGGCATCTGCACGGCGGTAGAGG
GAGATAACTGTGTGTTCGATGGGGTCATCTACCGCAGTGGAGAGAAATTTCAGCCAAGCT
GCAAATTCCAGTGCACCTGCAGAGATGGGCAGATTGGCTGTGTGCCCCGCTGTCAGCTGG
ATGTGCTACTGCCTGAGCCTAACTGCCCAGCTCCAAGAAAAGTTGAGGTGCCTGGAGAGT
GCTGTGAAAAGTGGATCTGTGGCCCAGATGAGGAGGATTCACTGGGAGGCCTTACCCTTG
CAGCTTACAGGCCAGAAGCCACCCTAGGAGTAGAAGTCTCTGACTCAAGTGTCAACTGCA
TTGAACAGACCACAGAGTGGACAGCATGCTCCAAGAGCTGTGGTATGGGGTTCTCCACCC
GGGTCACCAATAGGAACCGTCAATGTGAGATGCTGAAACAGACTCGGCTCTGCATGGTGC
GGCCCTGTGAACAAGAGCCAGAGCAGCCAACAGATAAGAAAGGAAAAAAGTGTCTCCGCA
CCAAGAAGTCACTCAAAGCCATCCACCTGCAGTTCAAGAACTGCACCAGCCTGCACACCT
ACAAGCCCAGGTTCTGTGGGGTCTGCAGTGATGGCCGCTGCTGCACTCCCCACAATACCA
AAACCATCCAGGCAGAGTTTCAGTGCTCCCCAGGGCAAATAGTCAAGAAGCCAGTGATGG
TCATTGGGACCTGCACCTGTCACACCAACTGTCCTAAGAACAATGAGGCCTTCCTCCAGG
AGCTGGAGCTGAAGACTACCAGAGGGAAAATGTAACCTGTCACTCAAGAAGCACACCTAC
AGAGCACCTGTAGCTGCTGCGCCACCCACCATCAAAGGAATATAAGAAAAGTAATGAAGA
ATCACGATTTCATCCTTGAATCCTATGTATTTTCCTAATGTGATCATATGAGGACCTTTA
TATCTGTCTTTTATTTAACAAAAAATGTAATTAACTGTAAACTTGGAATCAAGGTAAGCT
CAGGATATGGCTTAGGAATGACTTACTTTCCTGTGGTTTTATTACAAATGCAAATTTCTA
TAAATTTAAGAAAACAAGTATATAATTTACTTTGTAGACTGTTTCACATTGCACTCATCA
TATTTTGTTGTGCACTAGTGCAATTCCAAGAAAATATCACTGTAATGAGTCAGTGAAGTC
TAGAATCATACTTAACATTTCATTGTACAAGTATTACAACCATATATTGAGGTTCATTGG
GAAGATTCTCTATTGGCTCCCTTTTTGGGTAAACCAGCTCTGAACTTCCAAGCTCCAAAT
CCAAGGAAACATGCAGCTCTTCAACATGACATCCAGAGATGACTATTACTTTTCTGTTTA
GTTTTACACTAGGAAACGTGTTGTATCTACAGTAATGAAATGTTTACTAAGTGGACTGGT
GTCATAAACTTTCTCCATTTAAGACACATTGACTCCTTTCCAATAGAAAGAAACTAAACA
GAAAACTCCCAATACAAAGATGACTGGTCCCTCATAGCCCTCAGACATTTATATATTGGA
AGCTGCTGAGGCCCCCAAGTTTTTTAATTAAGCAGAAACAGCATATTAGCAGGGATTCTC
TCATCTAACTGATGAGTAAACTGAGGCCCAAAGCACTTGCTTACATCCTCTGATAGCTGT
TTCAAATGTGCATTTTGTGGAATTTTGAGAAAAATAGAGCAAAATCAACATGACTGGTGG
TGAGAGACCACACATTTTATGAGAGTTTGGAATTATTGTAGACATGCCCAAAACTTATCC
TTGGGCCATAATTATGAAAACTCATGATCAAGATATATGTGTATACATACATGTATCTGG
TTTGTCAGGCTACAAGGTAGGCTGCAAAATTAAATCTAGACATTCTTTTAATGCCACCAC
ACGTGTTCCGCTTCTCTCTTTTAAAGTATTTATAAAAATATAAATTGTACATTTTGTAAA
ATATTATGTTTGATTTCTCTACTTGTCATATCACTAAATAAACACGATTTTATTGCTGCG
TGACTCTGTATTACTTTGGTGCATAAAAGTTGAACATTGTTGTTTACTGAAAATAAAATT
AAAATTTATGAATTAAATGAG

Protein Sequence

>4856 : length: 357
MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDG
CSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSG
EKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDS
LGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQ
TRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRC
CTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM