ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4855

Name

NOTCH4

Synonym

INT3;notch 4;NOTCH4;notch 4

Definition

Notch homolog 4|neurogenic locus notch homolog protein 4

Position

6p21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch signaling pathway;PANTHER;P00045

Pathway

Transport of Notch receptor precursor to golgi;PID Reactome;500111

Pathway

Mature Notch receptor trafficks to plasma membrane;PID Reactome;500113

Pathway

Signaling by Notch;PID Reactome;500110

Pathway

A third proteolytic cleavage releases NICD;PID Reactome;500116

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Notch signaling pathway;KEGG PATHWAY;hsa04330

Pathway

NICD trafficks to nucleus;PID Reactome;500117

Pathway

Gene Expression;Reactome;REACT:71

Pathway

Signaling by Notch;Reactome;REACT:299

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Notch signaling pathway;PID Curated;200013

Pathway

Maturation of Notch precursor via proteolytic cleavage;PID Reactome;500112

Pathway

Dorso-ventral axis formation;KEGG PATHWAY;hsa04320

Pathway

Receptor-ligand binding initiates the second proteolytic cleavage of Notch receptor;PID Reactome;500115

Disease

PSYCH;GAD

Disease

HIV-1 control;GAD

Disease

Alzheimer's disease;GAD

Disease

schizophrenia;GAD

Disease

INFECTION;GAD

Disease

NEUROLOGICAL;GAD

External Links

Links to cell senescence gene database

4855

Links to epithelial mesenchymal transition gene database

4855

Links to ovarian cancer gene database

4855

Links to endometrial cancer gene database

4855

Links to iHOP

4855

Sequence Information

Nucleotide Sequence

>4855 : length: 6762
AGACGTGAGGCTTGCAGCAGGCCGAGGAGGAAGAAGAGGGGCAGTGGGAGCAGAGGAGGT
GGCTCCTGCCCCAGTGAGAGCTCTGAGGGTCCCTGCCTGAAGAGGGACAGGGACCGGGGC
TTGGAGAAGGGGCTGTGGAATGCAGCCCCCTTCACTGCTGCTGCTGCTGCTGCTGCTGCT
GCTGCTATGTGTCTCAGTGGTCAGACCCAGAGGGCTGCTGTGTGGGAGTTTCCCAGAACC
CTGTGCCAATGGAGGCACCTGCCTGAGCCTGTCTCTGGGACAAGGGACCTGCCAGTGTGC
CCCTGGCTTCCTGGGTGAGACGTGCCAGTTTCCTGACCCCTGCCAGAACGCCCAGCTCTG
CCAAAATGGAGGCAGCTGCCAAGCCCTGCTTCCCGCTCCCCTAGGGCTCCCCAGCTCTCC
CTCTCCATTGACACCCAGCTTCTTGTGCACTTGCCTCCCTGGCTTCACTGGTGAGAGATG
CCAGGCCAAGCTTGAAGACCCTTGTCCTCCCTCCTTCTGTTCCAAAAGGGGCCGCTGCCA
CATCCAGGCCTCGGGCCGCCCACAGTGCTCCTGCATGCCTGGATGGACAGGTGAGCAGTG
CCAGCTTCGGGACTTCTGTTCAGCCAACCCATGTGTTAATGGAGGGGTGTGTCTGGCCAC
ATACCCCCAGATCCAGTGCCACTGCCCACCGGGCTTCGAGGGCCATGCCTGTGAACGTGA
TGTCAACGAGTGCTTCCAGGACCCAGGACCCTGCCCCAAAGGCACCTCCTGCCATAACAC
CCTGGGCTCCTTCCAGTGCCTCTGCCCTGTGGGGCAGGAGGGTCCACGTTGTGAGCTGCG
GGCAGGACCCTGCCCTCCTAGGGGCTGTTCGAATGGGGGCACCTGCCAGCTGATGCCAGA
GAAAGACTCCACCTTTCACCTCTGCCTCTGTCCCCCAGGTTTCATAGGCCCAGACTGTGA
GGTGAATCCAGACAACTGTGTCAGCCACCAGTGTCAGAATGGGGGCACTTGCCAGGATGG
GCTGGACACCTACACCTGCCTCTGCCCAGAAACCTGGACAGGCTGGGACTGCTCCGAAGA
TGTGGATGAGTGTGAGACCCAGGGTCCCCCTCACTGCAGAAACGGGGGCACCTGCCAGAA
CTCTGCTGGTAGCTTTCACTGCGTGTGTGTGAGTGGCTGGGGCGGCACAAGCTGTGAGGA
GAACCTGGATGACTGTATTGCTGCCACCTGTGCCCCGGGATCCACCTGCATTGACCGGGT
GGGCTCTTTCTCCTGCCTCTGCCCACCTGGACGCACAGGACTCCTGTGCCACTTGGAAGA
CATGTGTCTGAGCCAGCCGTGCCATGGGGATGCCCAATGCAGCACCAACCCCCTCACAGG
CTCCACACTCTGCCTGTGTCAGCCTGGCTATTCGGGGCCCACCTGCCACCAGGACCTGGA
CGAGTGTCTGATGGCCCAGCAAGGCCCAAGTCCCTGTGAACATGGCGGTTCCTGCCTCAA
CACTCCTGGCTCCTTCAACTGCCTCTGTCCACCTGGCTACACAGGCTCCCGTTGTGAGGC
TGATCACAATGAGTGCCTCTCCCAGCCCTGCCACCCAGGAAGCACCTGTCTGGACCTACT
TGCCACCTTCCACTGCCTCTGCCCGCCAGGCTTAGAAGGGCAGCTCTGTGAGGTGGAGAC
CAACGAGTGTGCCTCAGCTCCCTGCCTGAACCACGCGGATTGCCATGACCTGCTCAACGG
CTTCCAGTGCATCTGCCTGCCTGGATTCTCCGGCACCCGATGTGAGGAGGATATCGATGA
GTGCAGAAGCTCTCCCTGTGCCAATGGTGGGCAGTGCCAGGACCAGCCTGGAGCCTTCCA
CTGCAAGTGTCTCCCAGGCTTTGAAGGGCCACGCTGTCAAACAGAGGTGGATGAGTGCCT
GAGTGACCCATGTCCCGTTGGAGCCAGCTGCCTTGATCTTCCAGGAGCCTTCTTTTGCCT
CTGCCCCTCTGGTTTCACAGGCCAGCTCTGTGAGGTTCCCCTGTGTGCTCCCAACCTGTG
CCAGCCCAAGCAGATATGTAAGGACCAGAAAGACAAGGCCAACTGCCTCTGTCCTGATGG
AAGCCCTGGCTGTGCCCCACCTGAGGACAACTGCACCTGCCACCACGGGCACTGCCAGAG
ATCCTCATGTGTGTGTGACGTGGGTTGGACGGGGCCAGAGTGTGAGGCAGAGCTAGGGGG
CTGCATCTCTGCACCCTGTGCCCATGGGGGGACCTGCTACCCCCAGCCCTCTGGCTACAA
CTGCACCTGCCCTACAGGCTACACAGGACCCACCTGTAGTGAGGAGATGACAGCTTGTCA
CTCAGGGCCATGTCTCAATGGCGGCTCCTGCAACCCTAGCCCTGGAGGCTACTACTGCAC
CTGCCCTCCAAGCCACACAGGGCCCCAGTGCCAAACCAGCACTGACTACTGTGTGTCTGC
CCCGTGCTTCAATGGGGGTACCTGTGTGAACAGGCCTGGCACCTTCTCCTGCCTCTGTGC
CATGGGCTTCCAGGGCCCGCGCTGTGAGGGAAAGCTCCGCCCCAGCTGTGCAGACAGCCC
CTGTAGGAATAGGGCAACCTGCCAGGACAGCCCTCAGGGTCCCCGCTGCCTCTGCCCCAC
TGGCTACACCGGAGGCAGCTGCCAGACTCTGATGGACTTATGTGCCCAGAAGCCCTGCCC
ACGCAATTCCCACTGCCTCCAGACTGGGCCCTCCTTCCACTGCTTGTGCCTCCAGGGATG
GACCGGGCCTCTCTGCAACCTTCCACTGTCCTCCTGCCAGAAGGCTGCACTGAGCCAAGG
CATAGACGTCTCTTCCCTTTGCCACAATGGAGGCCTCTGTGTCGACAGCGGCCCCTCCTA
TTTCTGCCACTGCCCCCCTGGATTCCAAGGCAGCCTGTGCCAGGATCACGTGAACCCATG
TGAGTCCAGGCCTTGCCAGAACGGGGCCACCTGCATGGCCCAGCCCAGTGGGTATCTCTG
CCAGTGTGCCCCAGGCTACGATGGACAGAACTGCTCAAAGGAACTCGATGCTTGTCAGTC
CCAACCCTGTCACAACCATGGAACCTGTACTCCCAAACCTGGAGGATTCCACTGTGCCTG
CCCTCCAGGCTTTGTGGGGCTACGCTGTGAGGGAGACGTGGACGAGTGTCTGGACCAGCC
CTGCCACCCCACAGGCACTGCAGCCTGCCACTCTCTGGCCAATGCCTTCTACTGCCAGTG
TCTGCCTGGACACACAGGCCAGTGGTGTGAGGTGGAGATAGACCCCTGCCACAGCCAACC
CTGCTTTCATGGAGGGACCTGTGAGGCCACAGCAGGATCACCCCTGGGTTTCATCTGCCA
CTGCCCCAAGGGTTTTGAAGGCCCCACCTGCAGCCACAGGGCCCCTTCCTGCGGCTTCCA
TCACTGCCACCACGGAGGCCTGTGTCTGCCCTCCCCTAAGCCAGGCTTCCCACCACGCTG
TGCCTGCCTCAGTGGCTATGGGGGTCCTGACTGCCTGACCCCACCAGCTCCTAAAGGCTG
TGGCCCTCCCTCCCCATGCCTATACAATGGCAGCTGCTCAGAGACCACGGGCTTGGGGGG
CCCAGGCTTTCGATGCTCCTGCCCTCACAGCTCTCCAGGGCCCCGGTGTCAGAAACCCGG
AGCCAAGGGGTGTGAGGGCAGAAGTGGAGATGGGGCCTGCGATGCTGGCTGCAGTGGCCC
GGGAGGAAACTGGGATGGAGGGGACTGCTCTCTGGGAGTCCCAGACCCCTGGAAGGGCTG
CCCCTCCCACTCTCGGTGCTGGCTTCTCTTCCGGGACGGGCAGTGCCACCCACAGTGTGA
CTCTGAAGAGTGTCTGTTTGATGGCTACGACTGTGAGACCCCTCCAGCCTGCACTCCAGC
CTATGACCAGTACTGCCATGATCACTTCCACAACGGGCACTGTGAGAAAGGCTGCAACAC
TGCAGAGTGTGGCTGGGATGGAGGTGACTGCAGGCCTGAAGATGGGGACCCAGAGTGGGG
GCCCTCCCTGGCCCTGCTGGTGGTACTGAGCCCCCCAGCCCTAGACCAGCAGCTGTTTGC
CCTGGCCCGGGTGCTGTCCCTGACTCTGAGGGTAGGACTCTGGGTAAGGAAGGATCGTGA
TGGCAGGGACATGGTGTACCCCTATCCTGGGGCCCGGGCTGAAGAAAAGCTAGGAGGAAC
TCGGGACCCCACCTATCAGGAGAGAGCAGCCCCTCAAACGCAGCCCCTGGGCAAGGAGAC
CGACTCCCTCAGTGCTGGGTTTGTGGTGGTCATGGGTGTGGATTTGTCCCGCTGTGGCCC
TGACCACCCGGCATCCCGCTGTCCCTGGGACCCTGGGCTTCTACTCCGCTTCCTTGCTGC
GATGGCTGCAGTGGGAGCCCTGGAGCCCCTGCTGCCTGGACCACTGCTGGCTGTCCACCC
TCATGCAGGGACCGCACCCCCTGCCAACCAGCTTCCCTGGCCTGTGCTGTGCTCCCCAGT
GGCCGGGGTGATTCTCCTGGCCCTAGGGGCTCTTCTCGTCCTCCAGCTCATCCGGCGTCG
ACGCCGAGAGCATGGAGCTCTCTGGCTGCCCCCTGGTTTCACTCGACGGCCTCGGACTCA
GTCAGCTCCCCACCGACGCCGGCCCCCACTAGGCGAGGACAGCATTGGTCTCAAGGCACT
GAAGCCAAAGGCAGAAGTTGATGAGGATGGAGTTGTGATGTGCTCAGGCCCTGAGGAGGG
AGAGGAGGTGGGCCAGGCTGAAGAAACAGGCCCACCCTCCACGTGCCAGCTCTGGTCTCT
GAGTGGTGGCTGTGGGGCGCTCCCTCAGGCAGCCATGCTAACTCCTCCCCAGGAATCTGA
GATGGAAGCCCCTGACCTGGACACCCGTGGACCTGATGGGGTGACACCCCTGATGTCAGC
AGTTTGCTGTGGGGAAGTACAGTCCGGGACCTTCCAAGGGGCATGGTTGGGATGTCCTGA
GCCCTGGGAACCTCTGCTGGATGGAGGGGCCTGTCCCCAGGCTCACACCGTGGGCACTGG
GGAGACCCCCCTGCACCTGGCTGCCCGATTCTCCCGGCCAACCGCTGCCCGCCGCCTCCT
TGAGGCTGGAGCCAACCCCAACCAGCCAGACCGGGCAGGGCGCACACCCCTTCATGCTGC
TGTGGCTGCTGATGCTCGGGAGGTCTGCCAGCTTCTGCTCCGTAGCAGACAAACTGCAGT
GGACGCTCGCACAGAGGACGGGACCACACCCTTGATGCTGGCTGCCAGGCTGGCGGTGGA
AGACCTGGTTGAAGAACTGATTGCAGCCCAAGCAGACGTGGGGGCCAGAGATAAATGGGG
GAAAACTGCGCTGCACTGGGCTGCTGCCGTGAACAACGCCCGAGCCGCCCGCTCGCTTCT
CCAGGCCGGAGCCGATAAAGATGCCCAGGACAACAGGGAGCAGACGCCGCTATTCCTGGC
GGCGCGGGAAGGAGCGGTGGAAGTAGCCCAGCTACTGCTGGGGCTGGGGGCAGCCCGAGA
GCTGCGGGACCAGGCTGGGCTAGCGCCGGCGGACGTCGCTCACCAACGTAACCACTGGGA
TCTGCTGACGCTGCTGGAAGGGGCTGGGCCACCAGAGGCCCGTCACAAAGCCACGCCGGG
CCGCGAGGCTGGGCCCTTCCCGCGCGCACGGACGGTGTCAGTAAGCGTGCCCCCGCATGG
GGGCGGGGCTCTGCCGCGCTGCCGGACGCTGTCAGCCGGAGCAGGCCCTCGTGGGGGCGG
AGCTTGTCTGCAGGCTCGGACTTGGTCCGTAGACTTGGCTGCGCGGGGGGGCGGGGCCTA
TTCTCATTGCCGGAGCCTCTCGGGAGTAGGAGCAGGAGGAGGCCCGACCCCTCGCGGCCG
TAGGTTTTCTGCAGGCATGCGCGGGCCTCGGCCCAACCCTGCGATAATGCGAGGAAGATA
CGGAGTGGCTGCCGGGCGCGGAGGCAGGGTCTCAACGGATGACTGGCCCTGTGATTGGGT
GGCCCTGGGAGCTTGCGGTTCTGCCTCCAACATTCCGATCCCGCCTCCTTGCCTTACTCC
GTCCCCGGAGCGGGGATCACCTCAACTTGACTGTGGTCCCCCAGCCCTCCAAGAAATGCC
CATAAACCAAGGAGGAGAGGGTAAAAAATAGAAGAATACATGGTAGGGAGGAATTCCAAA
AATGATTACCCATTAAAAGGCAGGCTGGAAGGCCTTCCTGGTTTTAAGATGGATCCCCCA
AAATGAAGGGTTGTGAGTTTAGTTTCTCTCCTAAAATGAATGTATGCCCACCAGAGCAGA
CATCTTCCACGTGGAGAAGCTGCAGCTCTGGAAAGAGGGTTTAAGATGCTAGGATGAGGC
AGGCCCAGTCCTCCTCCAGAAAATAAGACAGGCCACAGGAGGGCAGAGTGGAGTGGAAAT
ACCCCTAAGTTGGAACCAAGAATTGCAGGCATATGGGATGTAAGATGTTCTTTCCTATAT
ATGGTTTCCAAAGGGTGCCCCTATGATCCATTGTCCCCACTGCCCACAAATGGCTGACAA
ATATTTATTGGGCACCTACTATGTGCCAGGCACTGTGTAGGTGCTGAAAAGTGGCCAAGG
GCCACCCCCGCTGATGACTCCTTGCATTCCCTCCCCTCACAACAAAGAACTCCACTGTGG
GGATGAAGCGCTTCTTCTAGCCACTGCTATCGCTATTTAAGAACCCTAAATCTGTCACCC
ATAATAAAGCTGATTTGAAGTGTTAAAAAAAAAAAAAAAAAA

Protein Sequence

>4855 : length: 2003
MQPPSLLLLLLLLLLLCVSVVRPRGLLCGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGE
TCQFPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAKLED
PCPPSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQC
HCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGQEGPRCELRAGPCPP
RGCSNGGTCQLMPEKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTC
LCPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCI
AATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLC
QPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECL
SQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICL
PGFSGTRCEEDIDECRSSPCANGGQCQDQPGAFHCKCLPGFEGPRCQTEVDECLSDPCPV
GASCLDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAP
PEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGGCISAPCAHGGTCYPQPSGYNCTCPTG
YTGPTCSEEMTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCVSAPCFNGG
TCVNRPGTFSCLCAMGFQGPRCEGKLRPSCADSPCRNRATCQDSPQGPRCLCPTGYTGGS
CQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSL
CHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGY
DGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGT
AACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFE
GPTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPC
LYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDG
GDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCH
DHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFALARVLS
LTLRVGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETDSLSAG
FVVVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAP
PANQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRR
RPPLGEDSIGLKALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGCGA
LPQAAMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWLGCPEPWEPLL
DGGACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAR
EVCQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHW
AAAVNNARAARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAG
LAPADVAHQRNHWDLLTLLEGAGPPEARHKATPGREAGPFPRARTVSVSVPPHGGGALPR
CRTLSAGAGPRGGGACLQARTWSVDLAARGGGAYSHCRSLSGVGAGGGPTPRGRRFSAGM
RGPRPNPAIMRGRYGVAAGRGGRVSTDDWPCDWVALGACGSASNIPIPPPCLTPSPERGS
PQLDCGPPALQEMPINQGGEGKK