ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4830

Name

NME1

Synonym

AWD|GAAD|NB|NBS|NDKA|NDPK-A|NDPKA|NM23|NM23-H1;NME/NM23 nucleoside diphosphate kinase 1;NME1;NME/NM23 nucleoside diphosphate kinase 1

Definition

NDP kinase A|granzyme A-activated DNase|metastasis inhibition factor nm23|non-metastatic cells 1, protein (NM23A) expressed in|nucleoside diphosphate kinase A|tumor metastatic process-associated protein

Position

17q21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Metabolism of nucleotides;Reactome;REACT:1698

Pathway

Regulation of RAC1 activity;PID Curated;200165

Pathway

Arf6 downstream pathway;PID Curated;200079

Pathway

salvage pathways of pyrimidine ribonucleotides;BioCyc;PWY0-163

Pathway

De novo pyrimidine deoxyribonucleotide biosynthesis;PANTHER;P02739

Pathway

pyrimidine deoxyribonucleotides de novo biosynthesis;BioCyc;PWY0-166

Pathway

Arf6 trafficking events;PID Curated;200046

Pathway

pyrimidine ribonucleotides de novo biosynthesis;BioCyc;PWY0-162

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

Pathway

Purine metabolism;KEGG PATHWAY;hsa00230

Pathway

Pyrimidine metabolism;KEGG PATHWAY;hsa00240

Pathway

Regulation of CDC42 activity;PID Curated;200059

Pathway

granzyme a mediated apoptosis pathway;PID BioCarta;100035

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

endocytotic role of ndk phosphins and dynamin;PID BioCarta;100099

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

De novo pyrimidine ribonucleotides biosythesis;PANTHER;P02740

Pathway

pyrimidine ribonucleotides interconversion;BioCyc;PWY-5687

Pathway

De novo purine biosynthesis;PANTHER;P02738

Disease

CANCER;GAD

Disease

Neuroblastoma;OMIM

Disease

lymph node involvement and other histopathological indicators of high metastatic potential;GAD

Disease

colorectal cancer;GAD

External Links

Links to cell senescence gene database

4830

Links to epithelial mesenchymal transition gene database

4830

Links to ovarian cancer gene database

4830

Links to endometrial cancer gene database

4830

Links to iHOP

4830

Sequence Information

Nucleotide Sequence

>4830 : length: 1031
GCAGAAGCGTTCCGTGCGTGCAAGTGCTGCGAACCACGTGGGTCCCGGGCGCGTTTCGGG
TGCTGGCGGCTGCAGCCGGAGTTCAAACCTAAGCAGCTGGAAGGGCCCTGTGGCTAGGTA
CCATAGAGTCTCTACACAGGACTAAGTCAGCCTGGTGTGCAGGGGAGGCAGACACACAAA
CAGAAAATTGGACTACAGTGCTAAGATGCTGTAAGAAGAGGTTAACTAAAGGACAGGAAG
ATGGGGCCAAGAGATGGTGCTACTGTCTACTTTAGGGATCGTCTTTCAAGGCGAGGGGCC
TCCTATCTCAAGCTGTGATACAGGAACCATGGCCAACTGTGAGCGTACCTTCATTGCGAT
CAAACCAGATGGGGTCCAGCGGGGTCTTGTGGGAGAGATTATCAAGCGTTTTGAGCAGAA
AGGATTCCGCCTTGTTGGTCTGAAATTCATGCAAGCTTCCGAAGATCTTCTCAAGGAACA
CTACGTTGACCTGAAGGACCGTCCATTCTTTGCCGGCCTGGTGAAATACATGCACTCAGG
GCCGGTAGTTGCCATGGTCTGGGAGGGGCTGAATGTGGTGAAGACGGGCCGAGTCATGCT
CGGGGAGACCAACCCTGCAGACTCCAAGCCTGGGACCATCCGTGGAGACTTCTGCATACA
AGTTGGCAGGAACATTATACATGGCAGTGATTCTGTGGAGAGTGCAGAGAAGGAGATCGG
CTTGTGGTTTCACCCTGAGGAACTGGTAGATTACACGAGCTGTGCTCAGAACTGGATCTA
TGAATGACAGGAGGGCAGACCACATTGCTTTTCACATCCATTTCCCCTCCTTCCCATGGG
CAGAGGACCAGGCTGTAGGAAATCTAGTTATTTACAGGAACTTCATCATAATTTGGAGGG
AAGCTCTTGGAGCTGTGAGTTCTCCCTGTACAGTGTTACCATCCCCGACCATCTGATTAA
AATGCTTCCTCCCAGCATAGGATTCATTGAGTTGGTTACTTCATATTGTTGCATTGCTTT
TTTTTCCTTCT

Protein Sequence

>4830 : length: 177
MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRL
VGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETN
PADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE