ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4791

Name

NFKB2

Synonym

CVID10|H2TF1|LYT-10|LYT10|NF-kB2|p100|p52;nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100);NFKB2;nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)

Definition

DNA-binding factor KBF2|NFKB, p52/p100 subunit|lymphocyte translocation chromosome 10 protein|nuclear factor Kappa-B, subunit 2|nuclear factor NF-kappa-B p100 subunit|nuclear factor NF-kappa-B p52 subunit|nuclear factor of Kappa light chain gene enhancer

Position

10q24

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

B cell activation;PANTHER;P00010

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

T cell activation;PANTHER;P00053

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

Alternative NF-kappaB pathway;PID Curated;200037

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Toll receptor signaling pathway;PANTHER;P00054

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

External Links

Links to cell senescence gene database

4791

Links to epithelial mesenchymal transition gene database

4791

Links to ovarian cancer gene database

4791

Links to endometrial cancer gene database

4791

Links to iHOP

4791

Sequence Information

Nucleotide Sequence

>4791 : length: 3416
CTTCCTCTTCCGCTAACTTCCCGGCAGCGCGCCGCTCAGGGTGGGGGCCCCGAGGGCTGG
GGCCGTCGGCTTCCCCCTGGGGATCCCCCGCTTCAGAGAAAGCCAAGCGTTAGGCGCAGC
CAAAGCCGAGAGGCAGCGGAAGCTCCCGGCCCGGGGTGGCGCTGGGTCAGCGGGTACCTT
CTCGGCGGTCCCCTGGCCGGCCGAACTCGCGCCTGGTGTCCTGTCACCCCGCTCCCCGCC
CTGAGTGAGCCTGTCCCCTCTCAGGGGCGCGCCCGAGTCGCTCCGGGTTGGCTGCGCCAG
TCCAGAGTTAAACTTTCAGCCAATGAAAAAGGGCGCGAGGCGTGACGCACGGAAACGTCA
TGGGAATTCCCCCCTCCGGGGGGCCGAGAAGGGGCTTTCCCGGCCCTGAGCCCTGCTGGC
AGGCGAGGTGTCGCGACCGGTCCCAGGTGGGTCGGGCGCGGAGAGAAGCCGCAACCAGAG
CCGCCGCCACGGCGGGCGTCTAAAATTCTGGGAAGCAGAACCTGGCCGGAGCCACTAGAC
AGAGCCGGGCCTAGCCCAGAGACATGGAGAGTTGCTACAACCCAGGTCTGGATGGTATTA
TTGAATATGATGATTTCAAATTGAACTCCTCCATTGTGGAACCCAAGGAGCCAGCCCCAG
AAACAGCTGATGGCCCCTACCTGGTGATCGTGGAACAGCCTAAGCAGAGAGGCTTCCGAT
TTCGATATGGCTGTGAAGGCCCCTCCCATGGAGGACTGCCCGGTGCCTCCAGTGAGAAGG
GCCGAAAGACCTATCCCACTGTCAAGATCTGTAACTACGAGGGACCAGCCAAGATCGAGG
TGGACCTGGTAACACACAGTGACCCACCTCGTGCTCATGCCCACAGTCTGGTGGGCAAGC
AATGCTCGGAGCTGGGGATCTGCGCCGTTTCTGTGGGGCCCAAGGACATGACTGCCCAAT
TTAACAACCTGGGTGTCCTGCATGTGACTAAGAAGAACATGATGGGGACTATGATACAAA
AACTTCAGAGGCAGCGGCTCCGCTCTAGGCCCCAGGGCCTTACGGAGGCCGAGCAGCGGG
AGCTGGAGCAAGAGGCCAAAGAACTGAAGAAGGTGATGGATCTGAGTATAGTGCGGCTGC
GCTTCTCTGCCTTCCTTAGAGCCAGTGATGGCTCCTTCTCCCTGCCCCTGAAGCCAGTCA
TCTCCCAGCCCATCCATGACAGCAAATCTCCGGGGGCATCAAACCTGAAGATTTCTCGAA
TGGACAAGACAGCAGGCTCTGTGCGGGGTGGAGATGAAGTTTATCTGCTTTGTGACAAGG
TGCAGAAAGATGACATTGAGGTTCGGTTCTATGAGGATGATGAGAATGGATGGCAGGCCT
TTGGGGACTTCTCTCCCACAGATGTGCATAAACAGTATGCCATTGTGTTCCGGACACCCC
CCTATCACAAGATGAAGATTGAGCGGCCTGTAACAGTGTTTCTGCAACTGAAACGCAAGC
GAGGAGGGGACGTGTCTGATTCCAAACAGTTCACCTATTACCCTCTGGTGGAAGACAAGG
AAGAGGTGCAGCGGAAGCGGAGGAAGGCCTTGCCCACCTTCTCCCAGCCCTTCGGGGGTG
GCTCCCACATGGGTGGAGGCTCTGGGGGTGCAGCCGGGGGCTACGGAGGAGCTGGAGGAG
GTGGCAGCCTCGGTTTCTTCCCCTCCTCCCTGGCCTACAGCCCCTACCAGTCCGGCGCGG
GCCCCATGGGCTGCTACCCGGGAGGCGGGGGCGGGGCGCAGATGGCCGCCACGGTGCCCA
GCAGGGACTCCGGGGAGGAAGCCGCGGAGCCGAGCGCCCCCTCCAGGACCCCCCAGTGCG
AGCCGCAGGCCCCGGAGATGCTGCAGCGAGCTCGAGAGTACAACGCGCGCCTGTTCGGCC
TGGCGCAGCGCAGCGCCCGAGCCCTACTCGACTACGGCGTCACCGCGGACGCGCGCGCGC
TGCTGGCGGGACAGCGCCACCTGCTGACGGCGCAGGACGAGAACGGAGACACACCACTGC
ACCTAGCCATCATCCACGGGCAGACCAGTGTCATTGAGCAGATAGTCTATGTCATCCACC
ACGCCCAGGACCTCGGCGTTGTCAACCTCACCAACCACCTGCACCAGACGCCCCTGCACC
TGGCGGTGATCACGGGGCAGACGAGTGTGGTGAGCTTTCTGCTGCGGGTAGGTGCAGACC
CAGCTCTGCTGGATCGGCATGGAGACTCAGCCATGCATCTGGCGCTGCGGGCAGGCGCTG
GTGCTCCTGAGCTGCTGCGTGCACTGCTTCAGAGTGGAGCTCCTGCTGTGCCCCAGCTGT
TGCATATGCCTGACTTTGAGGGACTGTATCCAGTACACCTGGCGGTCCGAGCCCGAAGCC
CTGAGTGCCTGGATCTGCTGGTGGACAGTGGGGCTGAAGTGGAGGCCACAGAGCGGCAGG
GGGGACGAACAGCCTTGCATCTAGCCACAGAGATGGAGGAGCTGGGGTTGGTCACCCATC
TGGTCACCAAGCTCCGGGCCAACGTGAACGCTCGCACCTTTGCGGGAAACACACCCCTGC
ACCTGGCAGCTGGACTGGGGTACCCGACCCTCACCCGCCTCCTTCTGAAGGCTGGTGCTG
ACATCCATGCTGAAAACGAGGAGCCCCTGTGCCCACTGCCTTCACCCCCTACCTCTGATA
GCGACTCGGACTCTGAAGGGCCTGAGAAGGACACCCGAAGCAGCTTCCGGGGCCACACGC
CTCTTGACCTCACTTGCAGCACCAAGGTGAAGACCTTGCTGCTAAATGCTGCTCAGAACA
CCATGGAGCCACCCCTGACCCCGCCCAGCCCAGCAGGGCCGGGACTGTCACTTGGTGATA
CAGCTCTGCAGAACCTGGAGCAGCTGCTAGACGGGCCAGAAGCCCAGGGCAGCTGGGCAG
AGCTGGCAGAGCGTCTGGGGCTGCGCAGCCTGGTAGACACGTACCGACAGACAACCTCAC
CCAGTGGCAGCCTCCTGCGCAGCTACGAGCTGGCTGGCGGGGACCTGGCAGGTCTACTGG
AGGCCCTGTCTGACATGGGCCTAGAGGAGGGAGTGAGGCTGCTGAGGGGTCCAGAAACCC
GAGACAAGCTGCCCAGCACAGAGGTGAAGGAAGACAGTGCGTACGGGAGCCAGTCAGTGG
AGCAGGAGGCAGAGAAGCTGGGCCCACCCCCTGAGCCACCAGGAGGGCTCTGCCACGGGC
ACCCCCAGCCTCAGGTGCACTGACCTGCTGCCTGCCCCCAGCCCCCTTCCCGGACCCCCT
GTACAGCGTCCCCACCTATTTCAAATCTTATTTAACACCCCACACCCACCCCTCAGTTGG
GACAAATAAAGGATTCTCATGGGAAGGGGAGGACCCCTCCTTCCCAACTTATGGCA

Protein Sequence

>4791 : length: 900
MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGIC
AVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEA
AEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHL
LTAQDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQT
SVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEG
LYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRAN
VNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEEPLCPLPSPPTSDSDSDSEGP
EKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQ
LLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGL
EEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH