ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4781

Name

NFIB

Synonym

CTF|HMGIC/NFIB|NF-I/B|NF1-B|NFI-B|NFI-RED|NFIB2|NFIB3;nuclear factor I/B;NFIB;nuclear factor I/B

Definition

CCAAT-box-binding transcription factor|TGGCA-binding protein|nuclear factor 1 B-type|nuclear factor 1/B

Position

9p24.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

RNA Polymerase III Abortive And Retractive Initiation;PID Reactome;500579

Pathway

RNA Polymerase III Transcription;PID Reactome;500578

Pathway

RNA Polymerase III Transcription Termination;PID Reactome;500585

External Links

Links to cell senescence gene database

4781

Links to epithelial mesenchymal transition gene database

4781

Links to ovarian cancer gene database

4781

Links to endometrial cancer gene database

4781

Links to iHOP

4781

Sequence Information

Nucleotide Sequence

>4781 : length: 8692
GCACTCGCTCACGCTGCCCCTCGCGCACACACATGGTCGGCTCGCGGCAAAGTTTCGCCT
GCGATCACCACTCCGGGATCCTGCCGCAGTGCTTGGGGCTGTAACCTTGAACTTTCCCAG
CGCGGTGACACATTCTCCCCGCTCTCCCTCCCGCCCGCCCGCTCGCCCTCCTGCGCCCTC
CCGCGCCCCCCTCCCCGCCTTTTTTGAAAAAGCATTTTACCACCAACCACCACCCCAATC
CAACCCACACCGAACCTTCGCGCACCCCCTACACCCCAACAACAACAACAACTGCAAAAT
AGAAAACAAATCCCCAAACCCAGGCGAAAAGCAGCCAACACCGGCGGCGGCGGCGGCCTC
GGCAAGCACGGCCAGCGCGCTCGGACTGCAAGAGGGTTAAAAGTGTAGATTGGATTTCAC
CCCTGGAAATCTAGCACGCCGAGTGAACTTGAATCTTTGGCTATTTAAGGAGGACTGGGT
TTGTTGTGAAGTTGCGGTGATCCAGCGCAGAGCCCCGTCCTGATTGATCGCATCGCGGGG
CTCAGATGACTGTAAAATGAATAGATGAAATTCTTGCTTCTCGAAGATTTTCTTGGGCAT
CTCCCGGAAAGTGCGTTTTAAGGCGAAGTCATGATGTATTCTCCCATCTGTCTCACTCAG
GATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATGTCCGTGCAATTGCCTATACT
TGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAAGCGAATGTCA
AAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAG
AAGTGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAG
GACTTTGTGCTCACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGAC
CAGAAGGGTAAGATTAGGAGAATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTG
GATCTAGTCATGGTGATCCTGTTCAAAGGCATCCCCTTGGAAAGTACCGATGGAGAGCGG
CTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTGTCCAGCCACATCATATCACA
GTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCAAGATTCTGGA
CAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGAT
AGTTTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCC
ATAACCCAGGGAACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTAT
CATGACATGAACTCGGGGGTCAATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAA
AGACCCAAAACTATATCCATAGATGAAAATATGGAACCAAGTCCTACAGGAGACTTTTAC
CCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGCACGAAAGAGATCAAGATATG
TCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGCATCTCCACAG
GATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTT
GCACACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACA
CAAGCTATCCTTCCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCT
CCCCACCTGAATCCTCAGGATACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGT
CCACAAACCAGCCAGCCTAACGGCAGTGGTCAAGTAGTAGGGAAAGTGCCTGGCCATTTC
ACTCCTGTCTTGGCACCCTCTCCCCATCCCAGTGCAGTGCGACCTGTGACCCTGAGCATG
ACAGATACTAAACCCATCACTACATCCACTGAAGGTGAGGCAGCTTCACCTACAGCAACC
ACCTACACAGCCTCAGGCACATCTCAAGCCAATCGATATGTGGGACTAAGCCCAAGAGAC
CCATCCTTCCTACATCAGCAACAGCTGAGGATTTGTGACTGGACCATGAATCAAAACGGC
AGGCATTTATACCCCAGTACCAGTGAGGATACATTGGGAATTACTTGGCAAAGTCCTGGT
ACCTGGGCTAGCTTGGTTCCTTTCCAAGTGTCAAATAGGACACCCATCTTACCGGCCAAT
GTCCAAAATTACGGTTTGAACATAATTGGAGAACCTTTCCTTCAAGCAGAAACAAGCAAC
TGAGGGAAAAAGAAACACAACAATAGTTTAAGAAATTTTTTTTTTAAATAAAAAAAAAGG
AAAAGAGGAAGACTGGACAAAACAACACAAAGGCAGAAAGGAAAGAAACTGAAGAAAGAA
GATAATAGACCAGCAATTGCAGCACTTACAATCACTAATTCCCTTAAGGTTGAAACTGTA
ATGACATAAAAAGGGTCGATGATATTTCACTGATGGTAGATCGCAGCCCCTGCAACGTAG
CCTTTGTTACATGAAGTCCGCTGGGAAATAGATGTTCTGTCTCTATGACAATATATTTTA
ACTGACTTTCTAGATGCCTTAATATTTGCATGATAAGCTAGTTTTATTGGTTTAGTATTC
TTGTTGTTTACGCATGGAATCACTATTCCTGGTTATCTCACCAACGAAGGCTAGGAGGCG
GCGTCAGAGGTGCTGGGTGACAGAGCCATGAGCCAGCCATTTTATAAGCACTCTGATTTC
TAAAAGTTAAAAAAAATATATGAAATCTCTGTAGCCTTTAGTTATCAGTACAGATTTATT
AAATTTCGGCCCTTAACCCAGCCTTTTCCAGTGTGTAACCCAGTTTGAAATCTTAAAAAA
AGAAAAAATGAAAAAAAAAGGAAAAAAAGAAAAAAGGAAAAAAACAGTTTGAACACAAAG
GCTCTATGGAAGAAATGCCTCTATGTAGGTGAAGTGTTCTCTCTGCATGCAACAGTAAAA
ATTAATATAATATTTTCCCCACAAAAGAAACACTTAACAGAGGCAAGTGCAATTTATAAA
TTTATATCTAAAGGGGAATCATGATTATAAGTCCTTCAGCCCTTGGACTCTAAATTGAGG
GGATTAAAAAGAATTTAAAATAATTTTGAACGAATTTATTTTCCCCTCAGTTTTTGAGGG
CATTAAAAAGGCATTAAATCAAGACAAATCATGTGCTTGAGAAAAATAAAATTAATGAAA
ACACAGCACTTATGTTGGTTTAGCTGCAGCCTCCTTGGAGGTAGAATTTATTTATTTAAA
ATTACTGGTTGCATCAAGAACCCATAGGGTGTACAAAAGGTTCTATAAAATCTGCATTAT
AGAGACAAAGAGGCAGGCAAATCCATGTCACAAGGGTAAAGCTTACAGTTTACAAACTGG
GAACGCCAGGGTGTAGGATATAAAAACGCACTCTTGAGAAAACAAATGTAATCAGGGTGC
TGAAAACTTGCATGGTGCTTTCAGACATTAGCCTTGTTCAACAAATTTCTTGTATTGACA
GATCCATAGTGTGCATGGGCAGACACATTTTGCCTCTATGTCTCTTAAAATTTTAATTAA
AAATACTCTTTCCAGTAATCCTAATTTGCACGAAGATATAATGTCCACATTACGTGCCTT
GCCTTGAAATCTAAAAAACAAAAAACAAAAAAAAAAAAACAAAAAAATACAACAAAGTGA
CATCACTACACTTGTTTTGCTGCATTTATTATCATTTTAAATCTTTACCATTTTTATGAC
AAAATATTTTGTACTCCAGACGAAGAAAAATGTGTGACATCATGGATTTTTTAGACAGTT
ATACCTTTATCTCACATTTATAAAGCATATCATGGCTGTGTATAGTTGCCGCTTAAAAAT
TGTAATCGACCAGCAATATTTTCAGTATTTTGGTGTTTTTTTCTATTAACCTTTCATGTT
TTTCATCTTCCAATTAATATTTGGGGGGGAGGGGTTTCAAATTTATACGAATTATGCAAT
ACCAAGTTTTGCCTATGTAGGTAGTGCTTTTAGCTGTATTGGTTATTATAGGTAAGTACA
CAGATTTAAAAAAAAAATAATGTATGCTTTTTTGTTTGTTTGTTTGTTTTAATTGACCAA
AGTGGGTACTGCTATTTTTGCAGTGTGATGAGGTCCTTTTGTGTACTGAGAGATGGACAG
GGGATTTTTTTTAATATACATATATATATATTCTGGGGTGGGTGGGAGGATTTTTAACAC
TTTGCAGTGTAGCTGTGAAGCAGTGCACCCTGAGATGGGCCTGGGCTGCAAAGCGACTGT
TCTGCCTACTGTGACAAACTTCAACTTACACAGGTTCCCCTCTCTAACTTCCCACCTGGG
TTGCAAGCTGAACTCATTACTGGTTTTCATAACAACACAATAGTAAGAACAAGCAAACAC
AACAAATTCTCCTGGAGGCAGACTTGGCTTAAAAAGGCAGACTTGGCTTGGTGATAGTTT
TTCTTGAAAGTTCCAGATCCACAGTGGAGAGTGAGCCTGTCTCATATTTGGCAAAAATAT
TTGTTGAAATGTCCACATAGGGGATGTTGGATGTTTAACACTTTTGAGAGTTTAACACAT
GAATATTCTTTCTCCTAGAAAACACATTAGACCTGTTGGAGGGAGTCTCCCGTATTCCTT
TTCTGCCACTTTTCGTCCCCATTTCATTTCATTAATGATAGGATATGATTTACCTGTGAC
TTACTACTTCAAATGGATGGCAGTGCACTTGGATTTTTTTTTAATATCCAGAAGATTGAA
CAGAGGGTTGCTATTGTTGAATGTATTTGGACTGATAGATTAAAATCAAAGTTCAATTTT
TAAGGAACAAAAAAGTAAATCCTGTTTTCATTTTATCTCCCCTTTTAAAACTGAGAACCA
GAGCAGAAGGGAAATATAGAATTTTAAGCAATTAATCTTCCTGTGGATGAATTAAACCCA
TTAGATGCTGATGGGATTTTTTTAAGGAATGGTACCTTAACTATATATTTGATTTCGTTT
CCCCTGAGGGCTAGAGGCTGAATGGAGGCTGGTTTTATTTTGCCTTTCCCTCACCGCCCA
GTCCCATTGAGTGTATTCATTACTAGAAGGAAAATCTTTCAGAATTGGTGACACATGGTA
GGCTGTCTTAAGGAGTCCCCTGGCCCCCTTCCCCTAGGCCATGGCCTAATAAAATAAACT
GTCAATTGTTCTCACAGCATATCATTTAATAATGAATACTTTAGAACAATGCTTATGGGC
TGGAGAATTGTATTTGATTAGCCCATTCAGTTTGATAGCCCAAATGCTGAACAGCACAGC
GGGATCCTAGCAGTGCAAGTTCAAAAGTAAGTCCAATCATTTCTGTGATACTCGCCCTGG
TAGCAAACAGATCATCTCAGCCAAGCTCTTCATGTATCTTTGACCTATTAGGTGAACAAA
TGAACCTCACAGGACACACAGTATTTTTTAAAGGCAGACTCGCTCTCTTTTTTGCCAGTG
AGCAGTTCTAGCTAACCAAGTTACACACTGTGGGTATTCCTGCCTGCCTCTTGAATACAA
AGGCCTAGTTCAAGTGTTGCTTTTTTTATTTCAAATCAATTTTTTCTTCTTTCCTTTTTG
AGATAAAACTATTAAAAGTACTACTATATATATAAAATCTCAAATCAACTTTTCGGCCTC
CTCCTCGTGTACCAGGAAGTATATTCTGACGAAGGGCCCCACTTTTGCAGGTCTTGCACG
CCCCTCCCTTACCCAGAACTGCAGAGCTTCAGGATGGCGAAGGTCACCCAAGGGCATGAG
TAGGGAGTGGTGTCTCCAACCATCAGTTCCGTGGCACTGTTCAGCCTTTGTGTGCTGCCC
TGCCACCCACCACTCACAGTGCCTCTGAAGCGTGTTACCCCTGGAGTGACGTGAGCATTT
GAGGCTTGTCTAAGGAAAAAAATAAAAGGCAGTGAAGGAGACTGTACATAAAGACATGGC
AAAAATCTTAATTATAGCAATATAGTTATCGGGTAATGTTCGGGTGGGCAGCTCCATTAA
AAAATATGTGAATGAATCTGTGAAGCTGCAAGTAGCGAGAAGAGCGAAAGGTCTTCTTAA
TGAACCGCCTACCTTGTAGACAGTAATTTGTACACTGTATAGTTTTGTTAAGAATTTTTT
TTAAATTAAAATTCCCATGTTTGTAAAGCTAACTTTTTAACAATTATAATGGAACTATAT
GTTGTTTCCATTTTTAAAGTAAACAAGAATATTCCTTGTTTAGAGACTGGACTTGAGTTA
AAACTCTCCAGTCTCTTAAGTTATGTATTAAAAAGAAAATCTGTCCATGTTAGGAGTTAT
TTCACAGATTCCTGTGCTTGAAAAGCATAGGATACTAATCCTTTAAAAAAGTGTAAATGG
AGAAAAGTTATATTTTATGAAGGTTATTTTGTTGTATTTAGTATTGGAAAAGTTGGTTTC
CAGAGCATTTCAGAATGTCGAAGCACCACTGTCTTTTTATTAGTATATACGGCCTTTAGC
AAAAGTTTTTGTGATTGTTACGTGATGGTATTTAAGGTTAAGTTTCACAGAGCATTCAGG
ATAGGCAGAAAACTAAAACAGTGCTATGTCTCACATAACGTGTCCTCAGGGAGCAGAATC
TTGGATTTGTGACTTGTAGCTTCATAAGGACTCAACGAAAGAGATTGCACAGGGACATCT
TCAGCGGTGTGACAGCAGGACATGTTCTTTACCTAGATTCAAATTCTATGTACTGTGTGA
AATGATGAAGGCTGCAGAAAGTTATCCCATATTCAGTGTACAGTATTCATTTTTAATGAA
ACAACTCTACAATATTGCTGGCAGATAGGCCCCAAGCATGACATTCAATATAGTTTACAT
GTTCCTGTCAAGGTCTTTTGTTAACATTAACCAGCTGCATGCTTTCTGGACTTTAAGAAA
TTGGGTTTCTATAGAAAACTTTTTTTTTTTTTTTTTTTTTAATGTGCAGGCTATTCAAGT
TCAATAGTAAAAGCTCAAAAATGAATGTTCTACTCCATGCTGAAGGAGCTGAAAGCTGCC
TTCTTCATATTTTGCACTTTCTGGTAGTTCCCCTGTTTTTTCTAATTCCCTAAAATTGTG
TGGGTGGAGTGGAGCCCTGCAGTTGGGGGGTAACATGGACCACTGATTTTGCCCTTTGAC
CCTGCACAATGACCTTTGCATCAGCCAAACTCATTGCCATGACAACTCTTTGTACTGTGT
CCGTGCCACAGATCTGTTGGTCACATTGTTAATAGTAAAGGGGACAAGTTGGAGACGGTC
AATTTTTACATTTTTTGTTGCAATTTTTTCTTCAATGGTTGTAAGTAGTTTTTTTTTTTT
TTTAATAATAAAAGGGTTCACTAGTTAATACTCTAGAAATATCTGTGTGTTGCAATTCAA
ATGTATGTTGAGATTGTGAAAAGCGCTTCAGTGCCACTAGCTTACCGGTACACTAGACTA
AGCCCTTGATGACTTATTGCATGATACAGTACCAGGAACAACAGGTGGCCTAAATACATG
AAAAGCAGTGTAAGCTAGTGACACTAAAGCCAGTCTTGTATTACTGTATTTTTGACAGAA
TGGTTTTGAAAACTGTGCTACAGGGACTGATGTGGCAAATATATCTCTTTATGCAGAAGG
AAGTCTTTTTTTTTCTTTTTTTTTTTTTTAAGAAGTATGGCTTTTTATGCATCCTTCATC
GAGGGCATTGAAGTTGCATGGACTGATAAAAGTTGATGCAAAACAAGAAAGAAACAAACA
AAAAAAAAAAACCAGCAAAATGTTTACCAAAAAACTCAAACAAATGAGCAGTGCCTGTTC
AATTTCACAGTCTCTGTTGAGTTCAGTTGTAAATATGTTTCAAATGACATTTTCTTGGGA
AAAAAAATCTCTACAACATTGTAGAATGTGAGGGGTAACTACATCCCAGGCATAGGTTTC
TCAAAGCTGCAGTAGATTATGTCTTCATCAAGCTGTTAATTTGTGCTTATATCATATAGA
ACTTTTAGCATCCTGGGAAGAGCTGCCCCCACCTCAATGATATTTCTCTGAGAACAACTT
TTGTAGGACTGTGTGTTTCTTTAGATACATTTAGTACAACTGTAGGTGACGAGTAGTCAG
TTATTGCTTGCTAGCTACACACCAGGGTTGATCCATTTTAAAACTTTTGGCATTTTGTCC
TCATGGGCCATAAATACAGAACCTTGTATTTTAATTAAATTTTTTTACAAAAGGAGGCAC
ATGCACAATCTCCATGTAACAAACCTTTAGCAGTAGGATGTATTATACGACAGTTACTTA
ATTTCTAGAGTTCAGGCCTCTGGGATCAACCCCAGACTGGGCCAGAATGTTAGTGAAGGT
TTTATTGTGCCCGGTTGGAGGATAACGTTCTTTGGGTACTTTTTGTGGGTTGCAAATGAA
CTCAATTGCCACAAGTTTTAAACTGGTGTAAATCAAGCTTGACTTAATGTGATTGTTACT
GTTATATCCAGCCTATACTGCTAGCAGCTGCTCATACTGCAGTCAATTACTGGAAGCGGA
TATATTTCCTATGCAAAAACTGTTTAAACAATAAAATGAGCTATGCTACAGA

Protein Sequence

>4781 : length: 570
MMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDE
LLSEKPEIKQKWASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDC
LRQADKVWRLDLVMVILFKGIPLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFL
AYYVQEQDSGQSGSPSHNDPAKNPPGYLEDSFVKSGVFNVSELVRVSRTPITQGTGVNFP
IGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDENMEPSPTGDFYPSPSSPAAGS
RTWHERDQDMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGVAHSVISTRTP
PPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQPNGSG
QVVGKVPGHFTPVLAPSPHPSAVRPVTLSMTDTKPITTSTEGEAASPTATTYTASGTSQA
NRYVGLSPRDPSFLHQQQLRICDWTMNQNGRHLYPSTSEDTLGITWQSPGTWASLVPFQV
SNRTPILPANVQNYGLNIIGEPFLQAETSN