ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4739

Name

NEDD9

Synonym

CAS-L|CAS2|CASL|CASS2|HEF1;neural precursor cell expressed, developmentally down-regulated 9;NEDD9;neural precursor cell expressed, developmentally down-regulated 9

Definition

Cas scaffolding protein family member 2|Crk-associated substrate related protein Cas-L|Enhancer of filamentation 1 p55|cas-like docking|enhancer of filamentation 1|neural precursor cell expressed developmentally down-regulated protein 9|p130Cas-related pr

Position

6p24.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

4739

Links to epithelial mesenchymal transition gene database

4739

Links to ovarian cancer gene database

4739

Links to endometrial cancer gene database

4739

Links to iHOP

4739

Sequence Information

Nucleotide Sequence

>4739 : length: 4990
ACACATACATATGCCACTCACATCCGACGTGTGTGGTTGCTCAGTAGGGAAATGCTTACA
GCTGCCTCTAGAAGCAAGTCCGCTCGCTGCATGGAGAGGGAAACATGAGCATGCAGCAGG
ACTAGCTGTCACCTCCCGCCCGCCTGCCCAGAGAGGGCCAGAGCGTCGGGGAGGCAAGAT
GATCCACCAGCGGTTCCATCCTACACTTGGATTCAGTAAGCTGTGAGGTCCGTAATGTCA
GACACTGGCAAACATCATATGTTCTTCAAGTAGAGTTATGAAAACGAAGAAACTGGTCAG
AAGAGTAAAACGCCGGAATTGTCCTTTCCAACATCCAGAGCTGCATCATTCCTTGGGGCA
AAATGTGGACAAGGAGAATCAACCATCAACTGCACACAAATAAAAAAGCTCTGGGCACCG
TATCAAGCCAAGAACAGCCCAATCTCCTTTCTGGGCAAACGTTCCAAGAATCTTATGGCA
AGGGCCTTATATGACAATGTCCCAGAGTGTGCCGAGGAACTGGCCTTTCGCAAGGGAGAC
ATCCTGACCGTCATAGAGCAGAACACAGGGGGACTGGAAGGATGGTGGCTGTGCTCATTA
CACGGTCGGCAAGGCATTGTCCCAGGCAACCGGGTGAAGCTTCTGATTGGTCCCATGCAG
GAGACTGCCTCCAGTCACGAGCAGCCTGCCTCTGGACTGATGCAGCAGACCTTTGGCCAA
CAGAAGCTCTATCAAGTGCCAAACCCACAGGCTGCTCCCCGAGACACCATCTACCAAGTG
CCACCTTCCTACCAAAATCAGGGAATTTACCAAGTCCCCACTGGCCACGGCACCCAAGAA
CAAGAGGTATATCAGGTGCCACCATCAGTGCAGAGAAGCATTGGGGGAACCAGTGGGCCC
CACGTGGGTAAAAAGTACATTTGTAGAAATAATGTGAAGCCTATAAAGATGTTCTCTGCC
TCCAGAGAGAATTTTGTTTCCTTCTGCCAGCCTCATAGGCAAGCATACATCTGATTCCAT
GCTTTGAGCTGTTCTGGCAACCCTGATGTCTTCAGCCTGTGCAAGGGTGATAACCCCCGT
GAGGACAGGCCATGGCTACGTATACGAGTACCCATCCAGATACCAAAAGGACGTCTATGA
TATCCCTCCTTCTCATACCACTCAAGGGGTATACGACATCCCTCCCTCATCAGCAAAAGG
CCCTGTGTTTTCAGTTCCAGTGGGAGAGATAAAACCTCAAGGGGTGTATGACATCCCGCC
TACAAAAGGGGTATATGCCATTCCGCCCTCTGCTTGCCGGGATGAAGCAGGGCTTAGGGA
AAAAGACTATGACTTCCCCCCTCCCATGAGACAAGCTGGAAGGCCGGACCTCAGACCGGA
GGGGGTTTATGACATTCCTCCAACCTGCACCAAGCCAGCAGGGAAGGACCTTCATGTAAA
ATACAACTGTGACATTCCAGGAGCTGCAGAACCGGTGGCTCGAAGGCACCAGAGCCTGTC
CCCGAATCACCCACCCCCGCAACTCGGACAGTCAGTGGGCTCTCAGAACGACGCATATGA
TGTCCCCCGAGGCGTTCAGTTTCTTGAGCCACCAGCAGAAACCAGTGAGAAAGCAAACCC
CCAGGAAAGGGATGGTGTTTATGATGTCCCTCTGCATAACCCGCCAGATGCTAAAGGCTC
TCGGGACTTGGTGGATGGGATCAACCGATTGTCTTTCTCCAGTACAGGCAGCACCCGGAG
TAACATGTCCACGTCTTCCACCTCCTCCAAGGAGTCCTCACTGTCAGCCTCCCCAGCTCA
GGACAAAAGGCTCTTCCTGGATCCAGACACAGCTATTGAGAGACTTCAGCGGCTCCAGCA
GGCCCTTGAGATGGGTGTCTCCAGCCTAATGGCACTGGTCACTACCGACTGGCGGTGTTA
CGGATATATGGAAAGACACATCAATGAAATACGCACAGCAGTGGACAAGGTGGAGCTGTT
CCTGAAGGAGTACCTCCACTTTGTCAAGGGAGCTGTTGCAAATGCTGCCTGCCTCCCGGA
ACTCATCCTCCACAACAAGATGAAGCGGGAGCTGCAACGAGTTGAAGACTCCCACCAGAT
CCTGAGTCAAACCAGCCATGACTTAAATGAGTGCAGCTGGTCCCTGAATATCTTGGCCAT
CAACAAGCCCCAGAACAAGTGTGACGATCTGGACCGGTTTGTGATGGTGGCAAAGACGGT
GCCCGATGACGCCAAGCAGCTCACCACAACCATCAACACCAACGCAGAGGCCCTCTTCAG
ACCCGGCCCTGGCAGCTTGCATCTGAAGAATGGGCCGGAGAGCATCATGAACTCAACGGA
GTACCCACACGGTGGCTCCCAGGGACAGCTGCTGCATCCTGGTGACCACAAGGCCCAGGC
CCACAACAAGGCACTGCCCCCAGGCCTGAGCAAGGAGCAGGCCCCTGACTGTAGCAGCAG
TGATGGTTCTGAGAGGAGCTGGATGGATGACTACGATTACGTCCACCTACAGGGTAAGGA
GGAGTTTGAGAGGCAACAGAAAGAGCTATTGGAAAAAGAGAATATCATGAAACAGAACAA
GATGCAGCTGGAACATCATCAGCTGAGCCAGTTCCAGCTGTTGGAACAAGAGATTACAAA
GCCCGTGGAGAATGACATCTCGAAGTGGAAGCCCTCTCAGAGCCTACCCACCACAAACAG
TGGCGTGAGTGCTCAGGATCGGCAGTTGCTGTGCTTCTACTATGACCAATGTGAGACCCA
TTTCATTTCCCTTCTCAACGCCATTGACGCACTCTTCAGTTGTGTCAGCTCAGCCCAGCC
CCCGCGAATCTTCGTGGCACACAGCAAGTTTGTCATCCTCAGTGCACACAAACTGGTGTT
CATTGGAGACACGCTGACACGGCAGGTGACTGCCCAGGACATTCGCAACAAAGTCATGAA
CTCCAGCAACCAGCTCTGCGAGCAGCTCAAGACCATAGTCATGGCAACCAAGATGGCCGC
CCTCCATTACCCCAGCACCACGGCCCTGCAGGAAATGGTGCACCAAGTGACAGACCTTTC
TAGAAATGCCCAGCTGTTCAAGCGCTCTTTGCTGGAGATGGCAACGTTCTGAGAAGAAAA
AAAAGAGGAAGGGGACTGCGTTAACGGTTACTAAGGAAAACTGGAAATACTGTCTGGTTT
TTGTAAATGTTATCTATTTTTGTAGATATTTTATATAAAAATGAAATATTTTAACATTTT
ATGGGTCAGTCAACTTTCAGAAATTCAGGGAGCTGGAGAGGGAAATCTTTTTTTTTCCCC
CTGAGTGGTTCTTATGTATACATAGAAGTATCTGAGACATAAACTGTACAGAAAACTTGT
CCACGTGCTTTTGTATGCCCATGTATTCATGTTTGTTTGTAGATGTTTGTCTGATGCATT
TCATTAAAAAAAAAACCATGAATTACGAAGCACCTTAGTAAGCACCTTCTAATGCTGCAT
TTTTTTTGTTGTTGTTAAAAACATACCAGCTGGTTATAATATTGTTCTCCACGTCCTTGT
GATGATTCTGAGCCTGGCACTCCCAAATCTGGGAAGCATAGTTTATTTGCAAGTGTTCAC
CTTCCAAATCATGAGGCATAGCATGACTTATTCTTGTTTGGAAAACTCTTTTCAAAACTG
ACCATCTTAAACACATGATGGCCAAGTGCCCAAAAGCCCTCTTGCGGAGCAAATTTCAGA
ATATATATGTGGATCCAAGCTCTGATAGTTCAGGTGCTGGAGGGAAGAGAGACCTGTGTG
TTTAGAGGCCAGGACCACAGTTAGGATTGGGTTGTTTCAATACTGAGAGACAGCTACAAT
AAAAGGAGAGCAATTGCCTCCCTGGGGCTGTTCAATCTTCTGCATTTGTGAGTGGTTCAG
TCATGAGGTTTTCCAAAAGATGTTTTTAGAGTTGTAAAAACCATATTTGCAGCAAAGATT
TACAAAGGCGTATCAGACTATGATTGTTCACCAAAATAGGGGAATGGTTTGATCCGCCAG
TTGCAAGTAGAGGCCTTTCTGACTCTTAATATTCACTTTGGTGCTACTACCCCCATTACC
TGAGGGAAACTGGCCAGGTCCTTGATCATGGAACTATAGAGCTACCAGGACATATCCTGC
TCTCTAAGGGAATTTATTGCTATCTTGCACCTTCTTTAAAACTCACATATGCAGACCTGA
CACTCAAGAGTGGCTAGCTACACAGAGTCCATCTAATTTTTGCAACTTCCTGTGGCCAGT
GTGTATAACCCCTTCCACTATCTCACAGATAGTCACAGCGTCCATTCCATAGTCTGTCTC
CTCACATCTGTTAGTATTGACACAGCACAGACACCACAAGCCATCAGGTTCTTCATGGGG
CAGGTGAAATACTTCTACCCCATGGGTAAATGTATTCACATATTACCAAGAGAAGAAGCA
CATTATCTATGATCTTTTGGCCCAGTTCTTATTTAGCATTTTTATTCCAGCCTACTTGGA
AACATGTTTTTATTTGCAATATATGCCTGACTGAATTAAGCTTGCTTGTTTTAAACAACC
AAATCATTGGAACAGAAAAGGATTTAAAAAACAAGAATGCATGATCTCAGAGTGATTAAA
AAAAAATCAGTGGAAATAAATGATCATAGAAGGTGCTTTTCAAAACAACTGCTATTATAA
TTCTCAAAGTCCTACTCTGCCAAAAGAAGATTAAAAGTCATACATTACATTACAAGGAAA
TGTTCATGTGGGAAGAGGGTTGCTGAAAATCAACAACGCTTGAAGTTAAAAAGTGTGTCT
TTGTAGATTTCATTGTATAATGTGTATTTCTTAGGAGATGGCTGACTTGATTGATCTACG
CTAAGTGGAGACATTTCACATTTTTAAAACCAAATGTTCAATCTGTATTACTCTTTGCCG
TCTTGTATGTAGAGGCTATTTTTAAATCATTAAATTTTTAGATCTCTGTTTTCATAAAAA
AAAAAAAAAA

Protein Sequence

>4739 : length: 834
MKYKNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRV
KLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQV
PTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIP
PSHTTQGVYDIPPSSAKGPVFSVPVGEIKPQGVYDIPPTKGVYAIPPSACRDEAGLREKD
YDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPN
HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLHNPPDAKGSRD
LVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQAL
EMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELI
LHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPD
DAKQLTTTINTNAEALFRPGPGSLHLKNGPESIMNSTEYPHGGSQGQLLHPGDHKAQAHN
KALPPGLSKEQAPDCSSSDGSERSWMDDYDYVHLQGKEEFERQQKELLEKENIMKQNKMQ
LEHHQLSQFQLLEQEITKPVENDISKWKPSQSLPTTNSGVSAQDRQLLCFYYDQCETHFI
SLLNAIDALFSCVSSAQPPRIFVAHSKFVILSAHKLVFIGDTLTRQVTAQDIRNKVMNSS
NQLCEQLKTIVMATKMAALHYPSTTALQEMVHQVTDLSRNAQLFKRSLLEMATF