ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

4734

Name

NEDD4

Synonym

NEDD4-1|RPF1;neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase;NEDD4;neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase

Definition

E3 ubiquitin-protein ligase NEDD4|cell proliferation-inducing gene 53 protein|neural precursor cell expressed developmentally down-regulated protein 4|receptor-potentiating factor 1

Position

15q

Gene Type

protein-coding

Pathways and Diseases

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120

Pathway

ErbB4 signaling events;PID Curated;200009

Disease

CANCER;GAD

Disease

Chronic lymphocytic leukemia;NHGRI

Disease

Keloid;NHGRI

Disease

Chronic lymphocytic leukemia;GAD

External Links

Links to cell senescence gene database

4734

Links to epithelial mesenchymal transition gene database

4734

Links to ovarian cancer gene database

4734

Links to endometrial cancer gene database

4734

Links to iHOP

4734

Sequence Information

Nucleotide Sequence

>4734 : length: 7240
GCTGCAGCTGAGCTCAGCTTAAAGGTCGCTGGAAATCAAGTGCTTTGTAAGTGAAGGCAT
TTTGACTACAAGCGATTCAAGACATTTTGGAAACGTCAGTCTCTGGAATGGGTCGTCTTT
TTCTTTCTATGATATCTGGTATCTAATGTTTTACTTAGGATAAAGACTACTACTTAATAG
CTCTTTTAGGCACCACAAATGATTTTTTCTTTTGATGCAGTGCAGCTGCTTCTAGCCTGT
CTACGGACAGAGATCTTTGTTATGACTTTCAGCCCTTAACATGTTTGGAAATGAGAACAA
ATGGCACAAAGCTTACGATTGCACTTTGCAGCCAGAAGAAGCAATACTTACCCTTTGTCA
GAAACCTCCGGAGATGACTTGGATAGCCATGTTCACATGTGCTTCAAAAGACCAACACGG
ATTTCAACGTCTAACGTTGTTCAAATGAAGCTGACTCCCAGACAGACTGCACTAGCTCCG
TTAATAAAGGAAAACGTTCAGTCTCAAGAAAGATCATCTGTTCCCTCATCTGAAAATGTT
AATAAAAAGAGCAGCTGTCTACAGATTTCACTACAGCCAACAAGGTACAGTGGATATCTT
CAGTCTAGCAATGTCTTAGCTGATAGTGATGATGCTTCGTTTACTTGTATCTTGAAGGAT
GGTATTTACAGTAGTGCTGTGGTCGATAATGAATTGAATGCTGTGAATGATGGTCACCTT
GTAAGCAGTCCAGCCATTTGTAGTGGTAGCCTTAGTAACTTTTCAACCAGTGATAATGGG
TCTTACAGCAGCAACGGTAGTGATTTTGGGTCATGTGCAAGTATCACAAGTGGAGGTTCA
TATACTAACAGTGTCATCAGTGACAGTAGTAGTTATACTTTTCCACCAAGTGATGATACT
TTTTTGGGTGGAAACTTACCTTCTGACAGCACCTCCAATAGAAGTGTGCCAAACAGGAAT
ACTACTCCTTGTGAAATTTTTTCAAGAAGTACAAGTACAGATCCTTTTGTCCAGGATGAC
TTGGAACATGGATTAGAGATTATGAAATTGCCAGTGAGCAGGAACACAAAAATTCCACTA
AAACGTTACTCCTCCTTAGTCATTTTTCCTAGGAGTCCTTCAACTACCCGACCGACTTCT
CCAACAAGTCTGTGTACTCTTCTGAGCAAAGGATCCTATCAAACTTCACACCAGTTTATT
ATTTCTCCTAGTGAAATTGCACATAATGAGGATGGCACTAGTGCTAAAGGATTTCTTTCA
ACAGCTGTCAATGGACTTCGGTTATCTAAAACAATTTGTACCCCCGGAGAAGTAAGAGAC
ATACGGCCGCTTCACAGGAAGGGCTCGTTACAGAAGAAAATTGTTCTTTCGAATAATACT
CCCAGACAGACTGTCTGTGAAAAGTCATCTGAAGGATATTCTTGTGTTTCAGTGCATTTC
ACCCAACGAAAAGCAGCTACATTAGACTGTGAAACAACAAATGGTGATTGTAAACCAGAA
ATGTCAGAAATTAAGCTTAATTCTGATTCAGAGTATATTAAGCTCATGCATAGGACATCT
GCATGTTTGCCATCCTCCCAAAATGTAGATTGTCAAATAAATATCAATGGAGAATTGGAA
AGACCACATTCACAGATGAACAAAAACCATGGTATTTTACGAAGAAGTATTTCATTGGGA
GGAGCTTATCCAAATATTTCCTGTCTATCCAGCCTTAAGCACAATTGTTCTAAAGGGGGA
CCATCTCAGTTACTCATAAAGTTTGCATCTGGAAATGAAGGTAAAGTGGATAATTTATCA
AGAGACAGCAACAGAGATTGCACAAATGAACTGTCTAATTCTTGCAAGACAAGAGATGAT
TTCCTAGGTCAAGTGGATGTTCCACTTTATCCATTACCGACAGAAAATCCAAGATTGGAG
AGACCATATACATTTAAGGATTTTGTTCTTCATCCAAGAAGTCACAAATCAAGAGTTAAA
GGTTATCTGAGACTAAAAATGACTTATTTACCTAAAACCAGTGGCTCAGAAGATGATAAT
GCAGAACAGGCTGAGGAATTAGAGCCTGGCTGGGTTGTTTTGGACCAACCAGATGCTGCT
TGCCATTTGCAGCAACAACAAGAACCTTCTCCTCTACCTCCAGGGTGGGAAGAGAGGCAG
GATATCCTTGGAAGGACCTATTATGTAAACCATGAATCTAGAAGAACACAGTGGAAAAGA
CCAACCCCTCAGGACAACCTAACAGATGCTGAGAATGGCAACATTCAACTGCAAGCACAA
CGTGCATTTACCACCAGGCGGCAGATATCCGAGGAAACAGAAAGTGTTGACAACCGAGAG
TCTTCCGAGAACTGGGAAATTATAAGAGAAGATGAAGCCACCATGTATAGCAACCAGGCC
TTCCCATCACCTCCACCGTCAAGTAACTTGGATGTTCCAACTCATCTTGCAGAAGAATTG
AATGCCAGACTCACCATTTTTGGAAATTCAGCCGTGAGCCAGCCAGCATCGAGCTCAAAT
CATTCCAGCAGAAGAGGCAGCTTACAAGCCTATACTTTTGAGGAACAACCTACACTTCCT
GTGCTTTTGCCTACTTCATCTGGATTACCACCAGGTTGGGAAGAAAAACAAGATGAAAGA
GGAAGATCATATTATGTAGATCACAATTCCAGAACGACTACTTGGACAAAGCCCACTGTA
CAGGCCACAGTGGAGACCAGTCAGCTGACCTCAAGCCAGAGTTCTGCAGGCCCTCAATCA
CAAGCCTCCACCAGTGATTCAGGCCAGCAGGTGACCCAGCCATCTGAAATTGAGCAAGGA
TTCCTTCCTAAAGGCTGGGAAGTCCGGCATGCACCAAATGGGAGGCCTTTCTTTATTGAC
CACAACACTAAAACCACCACCTGGGAAGATCCAAGATTGAAAATTCCAGCCCATCTGAGA
GGAAAGACATCACTTGATACTTCCAATGATCTAGGGCCTTTACCTCCAGGATGGGAAGAG
AGAACTCACACAGATGGAAGAATCTTCTACATAAATCACAATATAAAAAGAACACAATGG
GAAGATCCTCGGTTGGAGAATGTAGCAATAACTGGACCAGCAGTGCCCTACTCCAGGGAT
TACAAAAGAAAGTATGAGTTCTTCCGAAGAAAGTTGAAGAAGCAGAATGACATTCCAAAC
AAATTTGAAATGAAACTTCGCCGAGCAACTGTTCTTGAAGACTCTTACCGGAGAATTATG
GGTGTCAAGAGAGCAGACTTCCTGAAGGCTCGACTGTGGATTGAGTTTGATGGTGAAAAG
GGATTGGATTATGGAGGAGTTGCCAGAGAATGGTTCTTCCTGATCTCAAAGGAAATGTTT
AACCCTTATTATGGGTTGTTTGAATATTCTGCTACGGACAATTATACCCTACAGATAAAT
CCAAACTCTGGATTGTGTAACGAAGATCACCTCTCTTACTTCAAGTTTATTGGTCGGGTA
GCTGGAATGGCAGTTTATCATGGCAAACTGTTGGATGGTTTTTTCATCCGCCCATTTTAC
AAGATGATGCTTCACAAACCAATAACCCTTCATGATATGGAATCTGTGGATAGTGAATAT
TACAATTCCCTAAGATGGATTCTTGAAAATGACCCAACAGAATTGGACCTCAGGTTTATC
ATAGATGAAGAACTTTTTGGACAGACACATCAACATGAGCTGAAAAATGGTGGATCAGAA
ATAGTTGTCACCAATAAGAACAAAAAGGAATATATTTATCTTGTAATACAATGGCGATTT
GTAAACCGAATCCAGAAGCAAATGGCTGCTTTTAAAGAGGGATTCTTTGAACTAATACCA
CAGGATCTCATCAAAATTTTTGATGAAAATGAACTAGAGCTTCTTATGTGTGGACTGGGA
GATGTTGATGTGAATGACTGGAGGGAACATACAAAGTATAAAAATGGCTACAGTGCAAAT
CATCAGGTTATACAGTGGTTTTGGAAGGCTGTTTTAATGATGGATTCAGAAAAAAGAATA
AGATTACTTCAGTTTGTCACTGGCACATCTCGGGTGCCTATGAATGGATTTGCTGAACTA
TACGGTTCAAATGGACCACAGTCATTTACAGTTGAACAGTGGGGTACTCCTGAAAAGCTG
CCAAGAGCTCATACCTGTTTTAATCGCCTGGACTTGCCACCTTATGAATCATTTGAAGAA
TTATGGGATAAACTTCAGATGGCAATTGAAAACACCCAGGGCTTTGATGGAGTTGATTAG
ATTACAAATAACAATCTGTAGTGTTTTTACTGCCATAGTTTTATAACCAAAATCTTGACT
TAAAATTTTCCGGGGAACTACTAAAATGTGGCCACTGAGTCTTCCCAGATCTTGAAGAAA
ATCATATAAAAAGCATTTGAAGAAATAGTACGACAACTTATTTTTAATCACTTTTAAATA
ATGTGTTGCATTTACACAGTTGTTTCATGCTGTCTTTAGAGTTAGGTGCCTGCCTAAAGC
CAGGCACCACCACACCTGGCTTTAGAGTTCACACAATAGGATATAAGTCCTGTATGACTT
AAATAGTGAATTTTGTCCTTAACATTTACCTCTTGTATAGTATCTGCCAGGCAGTTTTTT
CTTAAACTACTGAGATGATAACTGTGAAATATTTGTGATACGTGTCATGTGTGAAAAGTT
TGATGCATTTTGAGATGGAAAACTGAAATTTGGAAAAAGAAATACTTTACTATTGAGTAA
ACTACAATATATTTAGTGCTACTCGCAGCTATTTATTATTTTGTAGACCTGCCTTATGCA
CCTTACTGCCTAGATTTTTGGGAAAAAACTTTGGAAAGTGTGTTACCTATATTTCTAGCC
AACTAACTCACAGAAAAACTGTTTACTTCTTCACTTTCGAAGTATTTGGCTTTTGTTAAT
ATGCAGTTTTACTAAACAGATGGTTCATAAGACATGTGAAGCAAATTCATATTTGCAATG
GGTAAAAAGTATTAAAGCCTTTCTCTTGCCTGCATATCCTATTGACCATTGGTATAGTCA
TCACTTTTTCATATTTTAGTGTAGTTAGAAGAATTCCTTCTTCAAACATTAAAGATCCAC
AAAGCAGTATTTCTAAATATGCCTTGAAGAACTAAATGAAGTGTATAGCACTTGCCTTTA
CTAGATATTCTTTACACTTGTACAATTATGTAGTAAATGTATGTTTACAGGGTTTATCAT
GTTTACAGATTAAGCTAATTTCTGTAGTCGCATTTTTATATTTTTAGTATCACTCTAGTA
AAAAAACCAAATAATTTGTTTAAAATAACCAAAGAGTTGTTATAATGCATAATTTGTATT
AAATTTATTACTATTTCTTATGCCTTTTAAAATACTGTTTACTATGAAGACAATGTTTTT
AATTACAAATCCAGAATTCTGTAGGCAAAATGCTACAGTTCATATCTTCCTTTAACCAAA
CTGAAGTACATAAAGACCATGTACATGTATTCATCAAACGTTTATTGAATGCTGCGTGCC
TAGCGCTGTGCTATGCTCTGGGGTAAGAGTTGTCAGCTTCAGAGAAGCTGAGTCCTGATC
CTCAAGGAACTTGCAAATGTGTCTATGAATTTGTAAAACAATCAAAAGTAGGCGTAAGCA
GAATAAGGCAAAAGGGAAAGTGTTCTAGGTTCCAGCACACCTGCAAAGATAAAGTGTGCC
AAGACTGTATTTATATTTCATACTTATATTGTTTCATCCTTATATTGGAATGATTATATA
GAAAATGCTCTTAAAAAGATTAAACCTATTTCTCAGTATGGTATCTTGGTGATTTAGGAA
TAATTGTAAATATATGTTACGAATCTTCTTAAATATATATATATACACACCCTGTGAGAA
CTGTAAAAAGTACCTCTGGTTCTTGGTTTAAGTTTGTTGGGGTATAACATGATGAGTACT
CATTAGCACCTGATAGAAATCTGAAATGTGACAGTAGCAAAACCACTTTCTACTTTCCAA
ACACCACAGCATCAGCATGGTTTAGGGGAAGCAATTCACAGATTAATGTACCCTGCGTTT
TGTCTTCACCATTGTCAACCAGCAGTCAAGGATGAGCACCAGGTATAGTCCTGGTTTGAT
ATCTCACCAGCCATGTGAACTGAAGCAGCTTACTTAACCTCTCTGGATTCATATTTCTTC
ATCTGTCAAATGAGAGTAATCATGCCCACCCTCATTGTCATGCCAGATTGTCAGAAGTTC
CAGACAGATGAGAAAGCAAAAAGTACTTTGTAAAGTGTTATACAATCAGAAGGTGCTTTG
TGCTGACCGTCAGATTGTGTCAAGTCAGGTGTGCAAATTGACCACACTCCCAAAGAATCA
TTTAAAAGTAAAGTGACTTCTAAGAGACAAGGAAGTAGGAACATTTCTGATATTAAATAT
ATAAATAATATGGATACACATGTGTATATCTGTATATGGATCTTACCATCATAATTCATT
TTCTTCATATCAGCAAAGTAATAGTAATGTGGGCCAATGCATTTTGGAAATGTCCTCATT
ATGTAGAATGGAATGTGAAAATTATTTTTGTTAAAACAGGATTTTGCCACAATTATTTAA
ATATTATGTTTGTGAACTATCTAAGCATGAGAAAATACAAAGCTTTCTTTGTATCTGGCT
GATACTCATTTGGATGATTCTGTGACTCATAGAACATGATGTTAAATGAGACCAGACTCA
ACTGCCACCAGTCCCCAGCTGCAGACCTTCATCCCCTTCATCTCCCACTAGGGGCTCGTG
GTCTGGAAGAAACATCTATCAAGCAACACAGCCCCTTATCCCAGATAGAAAAGTGTCTCA
AATGCATTCTACTGCGGGACAGTCAGTAGGATCATTTTCATAAAGCAAGGACATCATATG
TTTCTAGAAATTACAAGCATATAACTTTAGCCTACAATCTCTTATTAAAAATTTTTAACA
AAATTGTATTACAAATGCATTTCATCAGAACTCAAATTTAAATGGTGTTTGTTTTGGGTT
TTTATTTATAATGCTGAAGTTATTCCATATAAGTATCAAGTTAAACACAATTCATTTTGA
TTATAAACTATTTGACTTTTTAAAATCTTCTGACACAGTAAATATATATATCAAGATTGA
TGTATCAAAATTTATTGCACACTTTAAAGTGTAAAATCATTTTTTAAAATCTTGAATCCA
CAAATAAAGTTCTATTCTGATTTTAAAAAACAAAACAAAA

Protein Sequence

>4734 : length: 1319
MAQSLRLHFAARRSNTYPLSETSGDDLDSHVHMCFKRPTRISTSNVVQMKLTPRQTALAP
LIKENVQSQERSSVPSSENVNKKSSCLQISLQPTRYSGYLQSSNVLADSDDASFTCILKD
GIYSSAVVDNELNAVNDGHLVSSPAICSGSLSNFSTSDNGSYSSNGSDFGSCASITSGGS
YTNSVISDSSSYTFPPSDDTFLGGNLPSDSTSNRSVPNRNTTPCEIFSRSTSTDPFVQDD
LEHGLEIMKLPVSRNTKIPLKRYSSLVIFPRSPSTTRPTSPTSLCTLLSKGSYQTSHQFI
ISPSEIAHNEDGTSAKGFLSTAVNGLRLSKTICTPGEVRDIRPLHRKGSLQKKIVLSNNT
PRQTVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLNSDSEYIKLMHRTS
ACLPSSQNVDCQININGELERPHSQMNKNHGILRRSISLGGAYPNISCLSSLKHNCSKGG
PSQLLIKFASGNEGKVDNLSRDSNRDCTNELSNSCKTRDDFLGQVDVPLYPLPTENPRLE
RPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDAA
CHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGNIQLQAQ
RAFTTRRQISEETESVDNRESSENWEIIREDEATMYSNQAFPSPPPSSNLDVPTHLAEEL
NARLTIFGNSAVSQPASSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDER
GRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSGQQVTQPSEIEQG
FLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSNDLGPLPPGWEE
RTHTDGRIFYINHNIKRTQWEDPRLENVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIPN
KFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMF
NPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFY
KMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSE
IVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLG
DVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAEL
YGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD