ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

473

Name

RERE

Synonym

ARG|ARP|ATN1L|DNB1;arginine-glutamic acid dipeptide (RE) repeats;RERE;arginine-glutamic acid dipeptide (RE) repeats

Definition

arginine-glutamic acid dipeptide repeats protein|atrophin 2|atrophin-1 like protein|atrophin-1 related protein|atrophin-1-like protein|atrophin-1-related protein

Position

1p36.23

Gene Type

protein-coding

External Links

Links to cell senescence gene database

473

Links to epithelial mesenchymal transition gene database

473

Links to ovarian cancer gene database

473

Links to endometrial cancer gene database

473

Links to iHOP

473

Sequence Information

Nucleotide Sequence

>473 : length: 8207
AGACGCTCGCGAGCAACCCTCCGCGCTCCGGAGCCTCCTCAGCCTCCCGCACACCCCGAG
ACGCTCGCCCCGCTGGGCCTCGGTCCCCGCCTCCTCCCCCGTCCTTTTCCCCTCTCTCGC
TCCCCACATTGTCTCTGCCTCATTTTCTCTCCTAGTTGAGGATTAAAAAAAAAAAAAAAT
CACCATCATCCTCAGGGAGCCCCCTCGCCCTCGGAAAACAAAACCAGACATGATCCTGGG
CTCCTGCTTCTGAAAGATCTGCCCGACCGAGGAGGAGGGAGCCTAGGTTCAAGTCGCAGG
AAAGGTCACGGCAGGGAAGCCCCCTCAGCCCCTCCGCGTCGCCTCCCCGCGGGCCGCCCC
TCTCGGCCCTGCGCCCCGCGGCCCCGCAGCCTCCGCGCGGCCTCCCGCCCCATCCCCGCC
ACTTTCCCCGGAGCTGGGCCGCGAACACCTCACTATTGATGGTGTAGCGCTTTAGGGGAA
GGAGGTGATTGTCTAGGAGTAACTGTATGTGCGCTCAGCACCGGGTCACAACCACCGTGG
GATCCACTTACAGAGAAGATTTGTGGAGAGCTTCAGCCTGTTTATGGTGTTACTGAGAAA
GGAATTGTGGCCATTTGATATAATTCTGGATGGAAGACCTCTTATTTGTATTACATTGAA
TTAGAGCATTTTTGAAACGTTGGGGTTGTTGGAGTGGTTGGATTTTCCCTGGAATTGAGT
GAGAAATTCAGAAGACTGAAGCCCAGGCTTACTGTCTACCTTTCACGGAGGCCTAGCCGT
GAGAGGACAGAAGAAGGCACGTGGCGAATCATGACAGCGGACAAAGACAAAGACAAAGAC
AAAGAGAAGGACCGGGACCGAGACCGGGACCGAGAGAGAGAGAAAAGAGACAAAGCAAGA
GAGAGTGAGAATTCAAGGCCACGCCGGAGCTGTACCTTGGAAGGAGGAGCCAAAAATTAT
GCTGAGAGTGATCACAGTGAAGACGAGGACAATGACAACAATAGTGCCACCGCAGAGGAG
TCCACGAAGAAGAATAAGAAGAAACCACCGAAAAAAAAGTCTCGTTATGAAAGGACAGAT
ACCGGTGAGATAACATCCTACATCACTGAAGATGATGTGGTCTACAGACCAGGAGACTGT
GTGTATATCGAGAGTCGGAGGCCAAACACACCGTATTTCATCTGTAGCATTCAAGACTTC
AAACTGGTCCACAACTCCCAGGCCTGTTGCAGATCTCCAACTCCTGCTTTGTGTGACCCC
CCAGCATGCTCTCTGCCGGTGGCATCACAGCCACCACAGCATCTTTCTGAAGCCGGGAGA
GGGCCTGTAGGGAGTAAGAGGGACCATCTCCTCATGAACGTCAAATGGTACTACCGTCAA
TCTGAGGTTCCAGATTCTGTGTATCAGCATTTGGTTCAGGATCGACATAATGAAAATGAC
TCTGGAAGAGAACTTGTCATTACAGACCCAGTTATCAAGAACCGAGAGCTCTTCATTTCT
GATTACGTTGACACTTACCATGCTGCTGCCCTTAGAGGGAAGTGTAACATCTCCCATTTT
TCTGACATATTTGCTGCTAGAGAGTTTAAAGCCCGAGTGGATTCATTTTTCTACATATTA
GGATATAACCCTGAGACAAGGAGGCTGAACAGTACCCAGGGGGAGATTCGTGTCGGTCCT
AGTCATCAGGCCAAACTTCCAGATCTGCAACCATTTCCTTCTCCAGATGGTGATACAGTG
ACCCAACATGAGGAACTGGTCTGGATGCCTGGAGTTAACGACTGTGACCTCCTTATGTAC
TTGAGGGCAGCAAGGAGCATGGCGGCATTTGCAGGAATGTGTGATGGAGGCTCTACAGAG
GACGGCTGTGTCGCAGCCTCTCGGGATGACACCACTCTGAATGCACTGAACACACTGCAT
GAAAGCGGTTACGATGCTGGCAAAGCCCTGCAGCGCCTGGTGAAGAAGCCTGTGCCCAAG
CTCATCGAGAAGTGCTGGACCGAGGACGAAGTGAAACGCTTCGTTAAGGGACTCAGGCAG
TACGGGAAGAACTTCTTCAGAATTAGAAAGGAGCTGCTTCCCAATAAGGAAACAGGGGAG
CTGATCACCTTCTATTACTATTGGAAGAAGACCCCCGAAGCAGCCAGCTCCCGAGCCCAT
CGTAGGCACCGCAGGCAGGCCGTGTTCAGGAGGATTAAGACTCGCACCGCGTCCACACCC
GTCAACACACCCTCCAGACCCCCGTCCAGTGAATTCTTGGACCTAAGTTCAGCCAGTGAA
GATGACTTCGACAGTGAGGACAGTGAGCAGGAGCTGAAGGGGTACGCCTGCCGCCACTGC
TTCACCACCACCTCCAAAGATTGGCACCACGGAGGCCGGGAGAACATCCTGCTTTGCACC
GACTGTCGCATCCACTTCAAGAAATACGGTGAGCTCCCGCCCATTGAGAAGCCCGTGGAC
CCGCCACCGTTTATGTTCAAACCCGTCAAGGAAGAGGATGATGGGCTCAGTGGGAAGCAT
AGCATGAGGACACGGCGGAGTCGGGGCTCGATGTCGACACTACGCAGTGGTCGGAAGAAG
CAGCCAGCCAGCCCTGATGGTCGCACCTCACCCATCAATGAAGACATCCGCTCCAGCGGC
CGGAACTCCCCCAGCGCTGCCAGTACCTCCAGCAATGACAGTAAAGCAGAGACAGTGAAG
AAGTCGGCCAAGAAGGTGAAGGAGGAAGCCTCTTCCCCTCTTAAGAGTAACAAACGCCAG
CGGGAGAAGGTGGCCTCTGATACGGAGGAGGCTGACAGGACCAGCTCCAAGAAGACAAAA
ACGCAGGAGATCAGCAGGCCCAACTCGCCATCTGAAGGTGAGGGAGAGAGTTCAGACAGT
CGCAGCGTCAACGATGAGGGTAGCAGTGACCCCAAAGACATCGACCAGGACAATCGCAGC
ACGTCCCCGAGCATCCCCAGCCCCCAGGACAATGAGAGTGACTCGGACTCGTCAGCCCAG
CAGCAGATGCTGCAGGCCCAGCCCCCAGCCTTGCAGGCTCCCACTGGGGTCACCCCAGCT
CCCTCCTCAGCTCCTCCAGGGACCCCTCAGCTGCCCACGCCAGGGCCCACGCCCTCTGCC
ACTGCAGTTCCCCCACAGGGCTCCCCCACGGCCTCCCAGGCCCCTAACCAGCCACAGGCT
CCCACAGCGCCTGTTCCCCACACCCACATCCAACAGGCACCGGCCTTGCACCCCCAGCGG
CCGCCCTCACCGCATCCCCCGCCGCATCCCTCGCCACATCCCCCGCTGCAGCCTCTGACT
GGGTCGGCGGGCCAGCCTTCTGCACCCTCTCATGCCCAGCCCCCACTGCACGGTCAGGGC
CCACCCGGCCCTCACAGCCTGCAGGCTGGGCCCCTGCTGCAGCACCCAGGCCCCCCACAG
CCCTTTGGCCTCCCTCCCCAGGCCTCCCAAGGCCAGGCCCCTCTGGGGACCTCCCCAGCA
GCAGCGTACCCTCACACCTCCCTGCAGCTGCCAGCCTCTCAGTCAGCGCTGCAGTCCCAA
CAGCCTCCACGGGAGCAGCCCCTGCCACCAGCGCCCTTGGCCATGCCCCACATCAAGCCC
CCGCCTACCACTCCCATCCCCCAGCTGCCGGCGCCACAGGCCCACAAGCACCCTCCCCAC
CTCTCGGGGCCCTCACCCTTCTCCATGAATGCCAACCTGCCTCCCCCTCCAGCCCTGAAG
CCCCTGAGCTCCCTGTCCACACATCACCCCCCGTCGGCTCACCCCCCACCCCTGCAACTC
ATGCCTCAGAGCCAGCCATTGCCCTCCTCGCCCGCCCAGCCCCCCGGGCTGACCCAGAGC
CAGAACCTGCCCCCGCCCCCTGCCTCCCACCCCCCTACAGGCCTCCACCAGGTGGCCCCC
CAACCCCCGTTTGCTCAGCACCCCTTTGTCCCTGGAGGCCCTCCTCCCATCACCCCTCCG
ACCTGCCCCTCCACCTCTACCCCACCGGCGGGACCTGGCACCTCGGCCCAGCCACCCTGC
TCTGGTGCGGCGGCTTCAGGAGGCAGCATAGCGGGGGGGTCGTCCTGCCCACTCCCCACC
GTCCAGATCAAGGAGGAGGCTCTGGACGACGCTGAGGAGCCTGAGAGCCCCCCTCCCCCA
CCAAGGAGCCCGTCCCCGGAGCCCACTGTGGTGGACACCCCCAGTCACGCCAGCCAGTCA
GCTAGGTTCTACAAACACCTGGACCGGGGCTACAACTCGTGTGCCCGGACAGACCTGTAC
TTCATGCCTCTGGCCGGGTCCAAGCTGGCCAAGAAGAGGGAGGAGGCCATTGAGAAGGCC
AAGCGCGAGGCTGAGCAGAAAGCCCGAGAGGAGCGAGAGCGGGAGAAGGAGAAGGAGAAG
GAGCGGGAGCGGGAGCGAGAGCGGGAGCGCGAGGCAGAGCGGGCGGCTAAGGCGTCCAGC
TCAGCGCATGAAGGTCGCCTCAGTGACCCACAGCTCAGTGGTCCTGGCCACATGCGGCCA
TCCTTCGAGCCACCACCAACCACCATTGCTGCTGTGCCCCCCTACATCGGGCCCGACACA
CCTGCCCTTCGGACTCTGAGCGAGTACGCCCGGCCCCACGTCATGTCGCCCACCAACCGC
AACCACCCCTTCTACATGCCCCTTAACCCCACGGACCCCCTGCTGGCCTACCACATGCCT
GGCCTCTACAACGTCGACCCCACCATCCGCGAGCGGGAGCTCCGGGAGCGGGAGATCCGA
GAGCGGGAGATCCGAGAGCGGGAGCTGCGGGAGAGGATGAAGCCGGGCTTCGAGGTGAAG
CCCCCAGAGCTGGACCCCCTGCACCCAGCCGCCAACCCCATGGAGCACTTTGCCCGGCAC
AGCGCCCTCACCATCCCCCCGACCGCCGGGCCCCACCCTTTTGCTTCTTTCCACCCGGGC
CTGAACCCCTTGGAGAGGGAGAGACTGGCCCTGGCGGGCCCCCAGCTGCGGCCCGAGATG
AGCTACCCTGACAGACTGGCAGCCGAGCGTATCCACGCAGAGCGCATGGCATCGCTGACC
AGCGATCCCCTGGCCCGACTGCAGATGTTCAACGTGACTCCGCACCATCACCAGCACTCT
CACATTCACTCCCACCTCCACCTCCACCAGCAGGACCCCCTCCACCAAGGTTCAGCAGGC
CCCGTTCACCCGCTGGTCGACCCCCTGACTGCCGGTCCCCACCTGGCTCGCTTCCCCTAC
CCGCCTGGCACTCTCCCCAACCCTCTGCTTGGACAGCCCCCACACGAGCACGAGATGCTT
CGCCACCCAGTTTTCGGCACCCCCTACCCCCGTGACCTGCCTGGGGCCATCCCACCCCCC
ATGTCAGCAGCCCACCAGCTGCAGGCCATGCATGCCCAGTCGGCCGAGCTGCAGAGACTG
GCCATGGAGCAGCAGTGGCTGCATGGACACCCCCACATGCATGGTGGCCACCTACCAAGT
CAGGAAGATTATTACAGTCGACTGAAGAAAGAAGGTGACAAGCAGTTATAAGTTATTTAT
TTGTTAACGCTGGCTGTGGAAACCCCAGTTCTTGGGGGGAGAAACAGGACTTTTTACATA
AAATAGGAGCTGCAAAAGCAAAAAGAATATCTTCTAAAGATTTCTTTATATATTTAAAAA
CCCACAACTAAAAATGTATCCACATAGTAGTGTTCGTTTGTCGAGAGGATTTCCTGAGAC
TGGTTTGGATCTCCCTGCATGACAGTCCCCCAGAAACTTAGTGAGTCCTGGACTGGACTG
AACATCCAGAAAGCTTCCCTGCAATCTTGGGGTTTGGCTTTAGTTTTCTTTTCCTTGATT
TCTCAGTAGGTGCTAGAATCCAGTTCACACCCTTCACTGTGCGTGCAGACACACTGACAC
ACTCCGCCACGAGTGCTCCAGAGCCCACGAGGCTTGCAGATCGGGGGCATAGGAATTTGG
AATCCAAGAGCTATAATTTTTAAAAAAAAAAATCTTTTATTTTAATACATTGTAGGAAAT
CTTCATAATTGGAGAAAGTTCTGCAGCATGGCTTTTTACGTCTGTAAATAAATAATTTTA
GAACAGCCTTTTTTTCTTCCATAAACTACTATTGTGATCTATTTTTTCCAGCCATGTCAC
TAATTGTGAATTCCTACCAACTATTGACAGAATACAGAGTTGATTTTTTAATAAAAAGTT
ATATATAATTATCCCTTTAATTAAAGGGAGCAAAGGGGCGTTCCACATGGACAGAGGCTT
GGACCGAGGCCTGGTCACAGCAGCGAGCATCCAGGGTTTGCAGGGACGATGTTACAGACT
CTGTTTTCTGCCTGGCGTTTCACTTGTGTCTGCTCCTAGCCTGTGCTCTGCCAGCAGCAC
AGACATCTGCTCCATCAGACCTCTTCCATTTTGCACAGGGAGTGCAGGAGGTGAATGTTC
ACTTTCTGTTCTCCAGTGTCACTGTTCTGTTTCCACGGGATGGAAAGCGCATGGGCCTGT
GTCCATTGTAGATTTCCTTCTAGATTTCTGTGTACACACACTTGATTGTTCTGGATGAAT
GTCTTTTTTAATACTCCGAAAATTTCATCATCTAAGAAAATGATTCCATACAAATAACTC
AGCACACAAGTGACCCAGGACATATGCCTGCCAAAGGGATGTGTTAGAAGGCTGCCTTCT
CATGCGCATTGTCACTTGGATCTTGTGGTGAGGACGGCCCCATCTTTCTTGCCACAGATT
GAGGCCACTTTTGAGCAAGGGAGATCCTGGAGTTAAGACAGGTGTTGGGGGCAGCCTGTA
TTTTACCCTAGGGGCAGGTCTGCATGGTGACCCCACATTGCACTGGTAAACCATTTGAGT
CCCACTCTTCATCCTGGAAGTGGGAACTGGAGTCCCACCCACAGTGCATTCAGAAAGCAT
GCTGTGTGGGGGCTGCTTCTCAGGAGGCCAGGCCCTTCTGAGCGGAACCGTCCTGGAGAG
AGCCTGCCCTCGTTTCCAGGCTGCAGCCGTAACGCACTTTCTCCCAGGCTGAGGGCGGGT
GTTCTGGGGTGTCTGCCCTCTGTCGGCCCTGCTTCCTGCCAGGACGTGGCCTCTTCCGAT
CCTTTTCTCTCAGACACTGGAGGTCTCTTCTGCCATTGTGCTGGTCCCATCCCAAGAATT
GTAGGACAGAGACCACACTGGGTCGGCGGACACAAAGTCCATCCAGGACCCAGGCCGCAG
AGGGAGCAGGAAGAGATGCTGATAGTTTGATCTAGAAACCAGCAGCTACTGGCTCAAATT
CAGGTTCTGGCGTCAAATAGCGACATTTCCAGTTTCTCTTAAAAACCGTGTTTGGTTTCA
GTTGGGATAGGCTTGTTTTGTCTGTTGAAAATGTTTCTAGTTTTTTTTCTTTCATTTTTC
TCTCATTCCATTTCTGCCTTAACTTTAGTTTGTTCACAGGGAGGCAAAGCTGACATGAAC
CTTTTGTCGTGGGACTTCAGGCCACATTGGCTTGAAGGCATTCGTTTCCTTCTGGGGTGG
GGACAGGCCCTCATGGCAGGCTTGTTCCCGTGGCTCTGAGCGAGGCCTCTTCCTGCTGGG
CTCCCAGACTCCTGCATCCAGGCCCCCACCTTCTCGGCTTCTGGTTTTTCTTTCTTTTTG
GTAGAACACAACATCTACCATTCAGTTAAACCTTCTTTATCTCCTCCTTTGGCATCCATT
TTTCCAAAGAAGAGTCGAGTCCTCTGAGGTCTGTGCTTGAAAGCCGTCCGAAGGCATTCT
TGTTAGCTTTGCTTTTCTCCCCATATCCCAAGGCGAAGCGCTGAGATTCTTCCATCTAAA
AAACCCTCGACCCGAAACCCTCACCAGATAAACTACAGTTTGTTTAGGAGGCCCTGACCT
TCATGGTGTCTTTGAAGCCCAACCACTCGGTTTCCTTCGGATTTTCCTCCCTTTGTTCGG
GGTTTGGTTTGGCTCCTCTGTGTGTGTCCGTATCTTGTTCGGTGTCCTCGAGGTTGAGCT
TCACTCCACTGCGGCAGAGGCAGCGTGCACACTCGGATTTGCTACGTTTCTATATATCTT
GAAGCTAAATGTATATATGAGTAGTTTGCCATGAGATAACACAGTGTAAACAGTAGACAC
CCAGAAATCGTGACTTCTGTGTTCTCTCCATTTGAGTATTTTGTAATTTTTTTGAAATAT
TTGTGGACATAAATAAAACCAAGCTACACTACAAAAAAAAAAAAAAA

Protein Sequence

>473 : length: 1566
MTADKDKDKDKEKDRDRDRDREREKRDKARESENSRPRRSCTLEGGAKNYAESDHSEDED
NDNNSATAEESTKKNKKKPPKKKSRYERTDTGEITSYITEDDVVYRPGDCVYIESRRPNT
PYFICSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGSKRDHL
LMNVKWYYRQSEVPDSVYQHLVQDRHNENDSGRELVITDPVIKNRELFISDYVDTYHAAA
LRGKCNISHFSDIFAAREFKARVDSFFYILGYNPETRRLNSTQGEIRVGPSHQAKLPDLQ
PFPSPDGDTVTQHEELVWMPGVNDCDLLMYLRAARSMAAFAGMCDGGSTEDGCVAASRDD
TTLNALNTLHESGYDAGKALQRLVKKPVPKLIEKCWTEDEVKRFVKGLRQYGKNFFRIRK
ELLPNKETGELITFYYYWKKTPEAASSRAHRRHRRQAVFRRIKTRTASTPVNTPSRPPSS
EFLDLSSASEDDFDSEDSEQELKGYACRHCFTTTSKDWHHGGRENILLCTDCRIHFKKYG
ELPPIEKPVDPPPFMFKPVKEEDDGLSGKHSMRTRRSRGSMSTLRSGRKKQPASPDGRTS
PINEDIRSSGRNSPSAASTSSNDSKAETVKKSAKKVKEEASSPLKSNKRQREKVASDTEE
ADRTSSKKTKTQEISRPNSPSEGEGESSDSRSVNDEGSSDPKDIDQDNRSTSPSIPSPQD
NESDSDSSAQQQMLQAQPPALQAPTGVTPAPSSAPPGTPQLPTPGPTPSATAVPPQGSPT
ASQAPNQPQAPTAPVPHTHIQQAPALHPQRPPSPHPPPHPSPHPPLQPLTGSAGQPSAPS
HAQPPLHGQGPPGPHSLQAGPLLQHPGPPQPFGLPPQASQGQAPLGTSPAAAYPHTSLQL
PASQSALQSQQPPREQPLPPAPLAMPHIKPPPTTPIPQLPAPQAHKHPPHLSGPSPFSMN
ANLPPPPALKPLSSLSTHHPPSAHPPPLQLMPQSQPLPSSPAQPPGLTQSQNLPPPPASH
PPTGLHQVAPQPPFAQHPFVPGGPPPITPPTCPSTSTPPAGPGTSAQPPCSGAAASGGSI
AGGSSCPLPTVQIKEEALDDAEEPESPPPPPRSPSPEPTVVDTPSHASQSARFYKHLDRG
YNSCARTDLYFMPLAGSKLAKKREEAIEKAKREAEQKAREEREREKEKEKERERERERER
EAERAAKASSSAHEGRLSDPQLSGPGHMRPSFEPPPTTIAAVPPYIGPDTPALRTLSEYA
RPHVMSPTNRNHPFYMPLNPTDPLLAYHMPGLYNVDPTIRERELREREIREREIRERELR
ERMKPGFEVKPPELDPLHPAANPMEHFARHSALTIPPTAGPHPFASFHPGLNPLERERLA
LAGPQLRPEMSYPDRLAAERIHAERMASLTSDPLARLQMFNVTPHHHQHSHIHSHLHLHQ
QDPLHQGSAGPVHPLVDPLTAGPHLARFPYPPGTLPNPLLGQPPHEHEMLRHPVFGTPYP
RDLPGAIPPPMSAAHQLQAMHAQSAELQRLAMEQQWLHGHPHMHGGHLPSQEDYYSRLKK
EGDKQL